SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010904 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010904
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.11e-81
Family IMD domain 0.0000000249
Further Details:      
 
Domain Number 2 Region: 381-448
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000534
Family SH3-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010904   Gene: ENSTNIG00000008079   Transcript: ENSTNIT00000011086
Sequence length 551
Comment pep:novel chromosome:TETRAODON8:8:8716865:8720770:-1 gene:ENSTNIG00000008079 transcript:ENSTNIT00000011086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSRTEEVNKMTENVYKGILDQFNPSLKNFVAMGKHYEKALTGVTVAAKGYFDALVKLGE
LASDSQGSKELGDTLFQMAEVHRQIQVQLEDVLKLFHSELLAQLEQKLELDIKYLTATLK
KYQSERRSKSESIERCQSQLKKLRRKSQGSRHPNKYGDREMQFVELMSRRQGELDALVAT
GYKSALTEERRRYCFLVDRQCCVTKLLINHHSKVRELLSQKLSSWQHSCSQPTKLPERAL
NLLRHTAPQTSGAAGIAEVLRHTKIGSAQPEQGTTVPIPHSAPHSPPLPHSAPLSRAMTP
VQLLHQQVGPGGSHTLSASHNPWFLKTTEMSATATLPLPRRPVSEMRVGGLSLSLSFPPF
RFPPSELLLSSAGSSLPRMLPLSGPTHVEAVFAHTPGASPGGGACLLHFLPGDDITLLIS
EPRDGWHYGQNERTGRKGWFPFSYTQPQHSRLDQLENSLLLSKANSTSTGQLDKLMMPAL
SGLTPESEEERSLPPQRVSTFRPRPYSMADSNKFTFSQEGTGAANAFRINPFAHIRLRKT
VTNDRSAPIIE
Download sequence
Identical sequences H3CRM0
ENSTNIP00000010904 99883.ENSTNIP00000010904 ENSTNIP00000010904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]