SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010995 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010995
Domain Number 1 Region: 22-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-18
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 144-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010995   Gene: ENSTNIG00000008169   Transcript: ENSTNIT00000011177
Sequence length 405
Comment pep:known_by_projection chromosome:TETRAODON8:6:2501237:2510222:-1 gene:ENSTNIG00000008169 transcript:ENSTNIT00000011177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVGRFSVCPYPDFADLGVPPPLPSCQYDMVGPEGIVESHQITRDGKAGATEAVDCKWYIR
APPRSKIYLRFLDYEMANSNECKRNFVAVYDGGSSVEDLKSKFCSTVANDLMLVSTLGVI
RMWADEASRRSRFRILFTTYQEPPCDADAFFCHSNMCINNTLVCNGVQNCVYPWDENQCK
EENRKASILDNLNNTNGTIIGVTCCIVLVLLIVSVIVQIKQPRKKYILRREDFDTMFQEV
FEPPHYELCTLRSAAAATAASADLVDLAEDFENYHGLRRASSRCIHDHHCGSSPNPGPAH
LSQLSLSGRGSRSNLSARDTLLTDLPQPPMAVRPLLPASGARRSIMVMKHSYSQEAADAG
CDLDDDLEEVPTTSHRLSRHEKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences H3CRW1
99883.ENSTNIP00000010995 ENSTNIP00000010995 ENSTNIP00000010995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]