SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011028 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011028
Domain Number 1 Region: 992-1234
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-31
Family Kelch motif 0.0049
Further Details:      
 
Domain Number 2 Region: 1549-1680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000377
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number 3 Region: 619-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 890-978
Classification Level Classification E-value
Superfamily Kelch motif 0.000000654
Family Kelch motif 0.032
Further Details:      
 
Domain Number 5 Region: 486-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 571-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000544
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 7 Region: 704-810
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000806
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011028
Domain Number - Region: 1720-1756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00153
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011028   Gene: ENSTNIG00000008201   Transcript: ENSTNIT00000011210
Sequence length 2184
Comment pep:known_by_projection chromosome:TETRAODON8:8:944169:955246:-1 gene:ENSTNIG00000008201 transcript:ENSTNIT00000011210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGSTGCLGLARFLSDCQSCLVFSGTPPSLARAPGEFGWCVQNESCLPVSERSACRVDQIS
GAYGWWGERTLFLTSLHSCRTENYVPGLHLLTFQHPRNDSQPDKVSILRSTTIILSPTTE
MDVALQFRGFIHPLWGAPPPASAPTETVSMWARIQRLHFEARMASGPNSSQLEVVGRWTA
QQEKELKLLSRADGTKLFSNLTRGNHYLVQAEGYLNNSGSGQASEMALIWNRTLPGGSEI
SFLFLEPYRSGSCSEYMSCLACLSDQSCGWCSSVSRCLLRNSADTCPEEDGDLKGEGWRH
LLLAPQHCPLCEEYRDCSACTQDPYCEWQINSSKKGDYQCSRRGRLDGSIRDPKGCPKVC
NQRKTCGECLSNSSQCAWCESAQACFYFAAYLTKYPYGECRDWYDSVHSVPQCKQCSALN
TCTECLRTFQCGWCGDYNNPTIGKCLRGDWAGMDDPLFYNCSVAVAEARATNEEQDAVWS
YPSCPDVEECRLGLHNCHPFATCINTPTSFECHCERGYTGDGTQHCNQTCYNECREGQCS
GSPRFECECSLGWTSDPPTLVLSGVECDVDCGCNFHSTCITAPGICDECQDWTTGPHCEH
CRPGSFGSALAGGSGCVPCECNGHGDPLQGYCHNQTGQCYCTHNTQGSHCESCLPGYYGD
PRNNGTCYRQCQGRSVLLSPASAAMPFSSSLGWLGGTEGKGGLSHCLWVLSVTEKLAPCL
PRQLCPPVALTLHPDSHTHCKSSFVYVFDGLPRFLSNGVVHSDHNLIGAFCGTTRAQPIT
VEATSGVISVYFEANVSSNKPQGFNASFWVRKCHQGSDEEEAGSPVCPSGSHCQGGICQC
PQGYGGPHCDRPVCPQDCGITEGRGTCNTSLGVCVCSDGWVGSDCSVPRDSNSLVWETLL
DTQLTVNQAHRFLHRMGHSLVSEPQGNLWMYGGLSLSEGMLGNVYRYSISERRWTQMLTS
ALEEGLTPRPRYHHASALLAHESGSGNHGASHSFMLVVGGVTPHGVTADTWSLNLSSLIW
REHPVSSSVLPPVAGHTLTVRRDSSVLLIGGYSPENGFNHHLLEFNPQSGNWTIAPHTGT
PPTGLYGHSAVYHEQTDAVYVFGGYRFHVETVEPSGELYSLYYPNLTWSLLVPSQGNKMF
LFFCHLSFSATQPLSRFFHSAALIKDTMVIVGGRTEEEDYSNSVSLYQINCNTWIHPSFS
SVSAVGDPVNRSVSLAMTSWDGQLFLSGGFNGVTLGRLITLSVPSDPCALLSSPEACNTT
TGSCVWCRGTCASSDSAERMGCTTGQSSCSPTPRQPEQCRRLKTCSECLARHPKTFSSPS
QNVQPSLQCKWCTNCPEGACISSSVSCTSEHDCRINQREIFLSSNCTETSCEASDCPKCT
ASGKCMWTRQFKRTGETRRILSVNPTYDWTCFSYALLNVSPMQVESSPPMPCPPPCHTLQ
NCSLCLGSRGSDGGWQHCVWSMALQQCMSPSFVPLRCEAGQCGRLLSGGDSCTPQCSQLT
QCSQCISRPQCGWCATRGGNGAGRCLQGGLDGVSEGVCPLRNSSWSFLHCPEEDECANGH
HHCNSTQDCHDLPQGFHCACKQGYILSSASGQCEPVCAQGCVNGTCMSPGACQCHFGFVG
DNCSSQCSCNKHSNCAGVNKPDVCLECHNNTIGKHCEKCKPLFVGSAKGGGTCRPCREFC
RGNSDVCLSRNEYRKAREHSRLFLLDPSSIPDWVSEGPTEENAVCVNCQNNSLGDKCESC
LGGYFLLQGKCEKCQCNGHADTCNEHDGTGCPCQNNTETPSCLSSPQSDRKDCYRQQCAK
CKDSFNGTPVNGRQCYRQFNVDTECCFDPTSQTNCFHDPTIRNLPKGRTVFFAAQPKFTN
VDIRVTIDVTFGEVEVYVSNSHDTFIVELDRNTGIHTIKIECYANASSSPGGPMLAHNPL
QLQAKPPGAEREIREERAEGLISYITVWKPQTVLIVRGVRDRVVITFPHEVHSLKSSRFY
IALRGMGTEGNEESQGLLFLRQDQAHIDLFVFFSVFFSCFFLFLSVCVLLWKVKQFLDFR
REQRRHIQEMTKMASRPFAKITIYLEPEEPQLIYLPSTAGSTVTHFCRSDPFLSQLMGFS
YSTFKVGPITLEPTDDGMAGVATVLFQLPGGVLAPNRACLGSALVTLRQNLQEYCGHGNG
GGHPGAGAGRKGLLGHQHLTTMAM
Download sequence
Identical sequences H3CRZ4
99883.ENSTNIP00000011028 ENSTNIP00000011028 ENSTNIP00000011028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]