SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011030 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011030
Domain Number 1 Region: 155-324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-47
Family SPRY domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011030   Gene: ENSTNIG00000008203   Transcript: ENSTNIT00000011212
Sequence length 334
Comment pep:known_by_projection chromosome:TETRAODON8:8:961304:964714:-1 gene:ENSTNIG00000008203 transcript:ENSTNIT00000011212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALEQKIQIFERKVTSYQTLTQNLDNTVDYIKNQASEAEKQIQVEFKKLRDALLTEERLR
LSELAQEEEQKIAAVQKLTKNVNQDISDLKKLIVSVKKEIGNEDLRLLQNFQDLKRKAQW
TRDDRCLSEDSLLNVGKHVGGLSFKIWKSLQNHVIYNPVVFDPNTASPWLSLDADLTAVK
ESHEPLITPDNPERFDPCGFVLGAEGYTSGKHRWDVMVRDCPSWVVGVCKEAVARKKKFT
LSPSRGVWCIGLSKGVCTAFTNERMALQVQQRLERIRIKLDMDKGEVSFWDGESATHLVT
LQHNFNVKIFPFFGPGVHSTSMILVPGKITMHTS
Download sequence
Identical sequences H3CRZ6
ENSTNIP00000011030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]