SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011056 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011056
Domain Number 1 Region: 36-220
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-62
Family Protein kinases, catalytic subunit 0.0000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011056   Gene: ENSTNIG00000008226   Transcript: ENSTNIT00000011238
Sequence length 231
Comment pep:known_by_projection chromosome:TETRAODON8:1:21931219:21933272:-1 gene:ENSTNIG00000008226 transcript:ENSTNIT00000011238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANVSLAYLSPPPLAPFDHRIVTPKPHQIASYYTINREEVLGGGRFGQVHKCMENSSGL
MLAAKIIKARSQKEKEVVRNEIQVMNQLNHANLIQLYAAFESRHDFILVMEYVEGGELFD
RIIDENYNLTELDTVLFIRQICEGLQYMHKMYILHLDLKPENILCVNRATNKIKIIDFGL
ARRYKPREKLKVNFGTPEFLAPEVINYEFVSFPTDMWSLGAQRPVSVSWRR
Download sequence
Identical sequences H3CS22
99883.ENSTNIP00000011056 ENSTNIP00000011056 ENSTNIP00000011056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]