SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011092 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011092
Domain Number 1 Region: 10-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family Laminin G-like module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011092   Gene: ENSTNIG00000008262   Transcript: ENSTNIT00000011274
Sequence length 1772
Comment pep:known_by_projection chromosome:TETRAODON8:18:9612234:9625578:-1 gene:ENSTNIG00000008262 transcript:ENSTNIT00000011274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPVPSAGELVDVLKVLELSEDMEGVSLEAGMCTSREGQELTDLAFRIDKKIQLSAPTRQ
LFPHSSFPMNFSVMTTVRAVKDSQVFLLSLYDSQGTQQLGLEIGRSPVFLYEDQEGQPSP
ELYPTFRKINLADGKWHRVAYSVEGQLVTLYLDCVRLDTLDLLRGLDPQVSTEGVTVFGT
RLLDEGVFEGDIQQLLLVGDPRAAETYCQDYIPDCDAPLPYDNILTEAEEEYLTEQENLQ
GRSGYPSLGITHILSLTSQPRRSTPPTRFCGSVLFAKVLGAKYAALLGKHPRTFLMLLIY
RLACSSKLERSARLSKLQQQGEAKIEQETSHKLAGLFCLNPRVEGTAKKHVVEEFEELDY
SDLFEDLPVSTGTAGPNVTDYEDLAEKGQKGEPGFYGAGTQLVGPHGPPGPEGERGPPGP
PGPVGPRGDPGELGPPGRPGLNGADGVAGPPGNVILLPFRAGGDPKTGTARSAQEAQAQA
ILQQTTLALKGPPGAMGLRGRSGPLGAPGPSGLKGSRGEMGPAGPPGLPGSPGQSGQMGK
RGQHGADGGRGEVGDVGVKGDRGFDGLPGLPGHKGHKGDRGKPGPAGPPGEQGERGSEGP
PGPRGQPGEAGPRGLPGSRGRPGPQGLTGMLGVDGVQGSKGNIGPPGEVGSPGQQGNPGI
MGFPGPQGLVGLPGEKGPQGKKGMQGLPGNDGPPGHPGREGAPGEKGLPGPQGVQGPVGY
PGQRGVKGADGIRGLKGSKGEKGEDGFPGAKGEMGERGDPGENGSPGSRGEDGPEGLKGQ
LGPLGELGPAGPTGEKGRLGLPGLPGYPGRQGSKGADGFPGGLGPEGEKGKKGPSGQPGG
VGQRGPNGARGARGAIGPTGKPGEKGVSGVDGPPGSAGERGPQGPQGRNGEPGPKGSNGP
VGKDGLPGHPGQRGEPGFQGKTGPLGPPGVVGPQGKSGEPGPTGDRGHPGAPGVPGEQGL
PGSAGKEGGKGDPGPPGSPGKNGPSGMKGFRGNRGAPGVMGPHGLKGALGPAGSPGALGP
SGERGPPGPAGAIGQPGRAGALGVAGPMGEKGEPGEKGPVGPAGKDGEQGPLGALGVIGP
PGPPGDDGDKGEQGEPGQKGSKGDKGEGGPPGPTGPQGPAGQLGVVGADGPVGPRGQQGM
YGPKGDEGSRGFKGAPGPPGLQGMPGLSGEKGESGHVGLMGPPGQLGPTGAQGPIGGQGP
TGRPGMVGQPGLVGEKGEDGEAGNPGPAGFSGMSGENGDPGEKGDMGLTGAPGPPGARGL
QGEDGPKGSMGPIGVTGDFGQPGEAGPNGVEGLPGVKGDPGDPGKPGTPGATGEPGPPGP
PGRRGHLGKPGKEGKEGLNGAKGPPGSEGLVGRTGPVGPQGHPGQPGVQGLRGIPGPPGE
QGLTGPPGQAGPPGPMGPPGILGLKGDHGKKGDKGHGGLIGLIGPPGDVGEKGDRGLPGN
EGLPGPKGDQGPLGLPGPLGPPGPTGVSGTIGLKGSKGNQGPIGPRGDTGPAGEPGPPGP
PASVTSPLPQRGYGRRTYSTLDGAAFEEGEGREGYGTEGQGMEEVFASLSSMKVEVEGLR
NPLGTFHSPARTCKELWLLRPELPNGDYWIDPNQGCHRDSFKVFCNFTAQGETCLYPDKK
FQSVKLAGWKGEKPGSWFSDFRKGKKFSYSGSEGVPVHVVQLTFLQLLSASAKQTFTYNC
LNSAAWLHGTSRNYQLALRFRGANEEELTQENTQYISALYDGCQSRSGQERTVLEFDAPL
SNTLPILDVAVSDFGNGNQKFGFQVGPVCYNG
Download sequence
Identical sequences H3CS58
ENSTNIP00000011092 99883.ENSTNIP00000011092 ENSTNIP00000011092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]