SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011106 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011106
Domain Number 1 Region: 14-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-251
Family Motor proteins 0.000000000555
Further Details:      
 
Domain Number 2 Region: 2089-2194
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000759
Family Second domain of FERM 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011106
Domain Number - Region: 1638-1723
Classification Level Classification E-value
Superfamily SH3-domain 0.00114
Family SH3-domain 0.0058
Further Details:      
 
Domain Number - Region: 1993-2078
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00496
Family UBX domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011106   Gene: ENSTNIG00000008276   Transcript: ENSTNIT00000011288
Sequence length 2310
Comment pep:known_by_projection chromosome:TETRAODON8:18:9493676:9515188:1 gene:ENSTNIG00000008276 transcript:ENSTNIT00000011288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYAILSMPTACHRPKRWAEGMEDMTQLPELNETTVVMNLKKRYDQELIYTYIGSILVSVN
PYKLLNIYGTDMVLQYASSSLSDNPPHLFAIANVSYTTMMDAKKDQCIIISGESGSGKTE
ATKVIMRYLTAIHHKSNITQQIEILEATPLLESFGNAKTVRNDNSSRFGKYTQIFMEEGV
ISGAITSQYLLEKSRIVFQAKSERNYHIFYEMLAGLPPNEKHPLYLQEAETYYYLNQGGN
CTIEGKDDGEDFRRLLNSMDILCFTPEEQSSIYRVLSSVLHLGNVYFQPHQAEGQEVASV
VSAQEIRVVAELLQVSPEGLQKSVTYKTTDTVREKIFTPLTVDSAVDSRDAVAKILYSLL
FNWLTERVNGRVYPHSEALSISILDIYGFEELQVNSFEQLCINYANETLQFFFNKVIFQE
EQEEYMREQIQWQEQPFSHNQACLDLIAAKPHGILRILDDQCNFPQATDHTFLQKCHYHH
ANDPLYARPKMPLPEFTLKHYAGKVTYQVHKFLDKNFDMVRQDVLDLFIQSKNKMVSSLF
LKHSESLSQQRSNMRRSSTARRYQANTVSAKFQTSLEELLNKMERCNPYFVRCIKPNHLT
PLPSAEGCLVMAQLRYCGIMETIQIRKEGYPARFHFHAFLSSHRYKGLLCLRDLPPADGE
NCVKMLHKLGPVKSGSYQLGVSKIFLKEELHQLLEGKRDRLLSIAALTLQRYTRMYFVRK
NFTRFRRRVVMFEARCRGYMERKKFALRRRCLIRFRSPVLLITVLQRYMRDRVNREVVNV
TTLPIPAELAALLHAASGGEELHSDCLAVVQAPTVDVDPQLTLPLDINNYLMTHYIRAIF
REPLFGMLTAPLENSLLRMDDDHKQGAVNTFILIMRFMGDPNLNGAQENLFGNYIIQKGL
SNPELRDEILAQVANQVWRNPNILNSERGWLLLSSCLSTFLPSQRMAKFLLKFVSDYGPE
GYNCVCQHQLIQALQRLNVGPDCVRTYPPCLLEWTANRKRANTVLHIYCFDGVSFLCPVH
SWTTGEEMAKDILQHRGVLEGRRGWSVLLKETAQWVELEGSDYVLDLMSDLELPADFPKR
SSYFIISAQEPTRVRPNASISLLGGGFDLSNDVFSSTIPGSDGLGRCLNKPLKSVIQHLP
VLSADFEPQRSMDRYLDSLFDPVLSDGIEETQSAARLSSRMKGAGGVGGGWHQQGQTTGP
PPPPGEAQRSAVSPQRQTLMDQQAVTVVNFLCGRENLLSAVVVNPTPYATANIPPSPYPP
AAQREQTPLQPEAQPPAEPAVQPQPVSPLPDSKPHPSSVKTEPTQPKAQAATRVLVLDPV
KPSLPPPAGDVVKYSSQLSDHIVPSHDVQNIIRRYNSPPPAAEPLPPGKGRPEGKFKKKQ
NPRDEALQILRPQMDNPPAPQVVKETESKPTKSTKKRAPERTLPIPPPVSRELPVETECI
QTQLHQRTNEEHYTYTNVPWRLYLRKEVFYPKDSFNNPLVLDLIFKQIVNDTLSEACVRI
TREERQKMKALFAKHGVEQNMDPVEEHVKKTIVTAARETWEIYFSRLFPASGSVGTGVQV
LSVSHSGIKLLKTVKSSAAAPDYFRVLRPYTYADILFVTIPSENMLEFNLTNEKLILFSA
KAPQVKHLIDTFINEIKKDSEYVIAERNFVTDDRSMLSFHKSDMIRLQVMDGLEKGYSYG
CVVKKKVVFLEELKRETPDFGWKFGAVFSRSGAFPADCVRPIAAPDFLSLPLERTTEPRG
GAGQFAVSSAVAVAVASTMAAYEIDQTIERVPLDGFSDGELDERVLQDPRYDILEFAKKY
FRYGPKGKGDSTKSKIKNRELAEPADMIKFSKTPLTESLIEFTDPVMNRVAADLFLLVMR
FMGDSPLKGLTEQEVVSTFLKLIGEFTLMRDEAYCQLLKQLTANTSSKPDSCQRGWRLLY
ILTAFHHCSEVLKPFLLKYLGQASVSAGVQYQGIAKACEQNLKKTFQYGGRLVPPSSMEL
NAMMAGRSSKRQLVLFPGGIERHVKIKTCSVALEVIEELCYEMGLHRLEAIKEYAVFLVT
GRGKNVRPLNKQEYILDVATEAELADTNYSFWFRRVIWSQPLKFDNELCVAMHYNQILPD
YRKGLLNVLPDGKVSDQQFHQISKLAALQHRAKDIMFIPSIHELSEYIATPLFKKQPPQQ
WVAMVTQHMQQAQALNPHQARAQFLGLVSAFPMFGSSFLYIHSSSSTTFYAPSILAANQR
GLHFLHKNTHEVMSVVPLVEVQSSRTQRPSTGTSYPYVDLTLGDMNTQRVVQLQLEQGLE
LCRVIAMQVENMMSARDKRLTLPPSEITML
Download sequence
Identical sequences H3CS72
ENSTNIP00000011106 99883.ENSTNIP00000011106 ENSTNIP00000011106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]