SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011128 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011128
Domain Number 1 Region: 16-263
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-28
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011128   Gene: ENSTNIG00000008298   Transcript: ENSTNIT00000011310
Sequence length 720
Comment pep:known_by_projection chromosome:TETRAODON8:8:8277685:8281624:-1 gene:ENSTNIG00000008298 transcript:ENSTNIT00000011310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSLARSAPSELNHWWSQLRFRLQNKKGWNEMLDETFLLYTKHINNIPLFYAAQKNNAG
CIKKLLGCSSTNIFERGALGETALHIAVMNDSLDAAVALMDGAPELINEPMTSELFQGLT
PLHIAVVNQNINLVQHLISRGGDVATPQVSGLYFRKRIGGLIYYGEHVLSFAACTGNEDI
ISMIINAGASTRVQDYRGNTVLHILILQPNKTIACQAIDLIMARDAELDQAVPLDMVPNS
RGLTPFKLAAKEGNSVAFQHLVNKRRLVQWSLGPLTSYLYDLTEIDSWADNMSVLEIIVA
SQQKEARGILELTPVRQLVSLKWNLYGKHYFRLLLFLYLLYIGTFTLCCIFRPLKDISEN
YTRTDMDQTIRIQKTLQENYVTYGDRLRLVGEVISVLGALVILVLEIPDIIRVGAKRYFG
QTALGGPFHVILISYACLVVLLCVFRACEVHGETVLMALCLVLGWCNVMFFARGFEMLGP
YVIMIQKIIFGDLTKFMWLSFIVLIGSSTALWVVYMTQDPNALPAYRSFPITLFSQFELS
VGLIDLPVDHTITTPPIIHVLHFTFSMVSCILLLNLLIAMMSDTHWRVAQERDELWRIQV
VATTLMLERRLPRCLWPRLGVCGLEYGLKERWYLRVEDRNDPMFQKMRRYIKAFSKEDET
EAKTDTAKGLKPTLPLPGLSATEEFPNRKSLTGWQMIRHSALGLEFGQEEKGDDQDIKFV
Download sequence
Identical sequences H3CS94
ENSTNIP00000011128 99883.ENSTNIP00000011128 ENSTNIP00000011128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]