SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011133 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011133
Domain Number 1 Region: 264-461
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000511
Further Details:      
 
Domain Number 2 Region: 14-150
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-29
Family SH2 domain 0.000000335
Further Details:      
 
Domain Number 3 Region: 200-257
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011133   Gene: ENSTNIG00000008303   Transcript: ENSTNIT00000011315
Sequence length 461
Comment pep:known_by_projection chromosome:TETRAODON8:3:2922155:2930533:1 gene:ENSTNIG00000008303 transcript:ENSTNIT00000011315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVFDHDEYRPPVWKSYLYQLQQEAPHPRRLTCTSEVDNRPKYYGREYHGMISREEAD
QLLSQAEGSYLIRESQRQPGTYTLALRFGNQTRNFRLYHDGKHFVGEKRFESIHDLVTDA
LITLYVETKAAEYIAKMTINPIYEHVGYTTLNQEPALKEHLPLSPETPDGPIPAKDDHNT
EERLSSLVRRSTLKESDLAPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKVVPNDCQPDLRHVKKVYSCDLTTLVKAHNTKRPMVVDMCIQELEARGLQSE
GLYRISGFSELIEDVKLAFDRDGEKADISANAYEDINIITGALKLYFRELPIPLITYDAY
PRFIEAAKITDPEKRLESLHEALKLLPPAHYETLRYLMAHLKRSRVVQHEKDNLMSSENL
GIVFGPTLMRAPDLDAMTALNDIRYQRLVVESLITNEDVLF
Download sequence
Identical sequences H3CS99
99883.ENSTNIP00000011133 ENSTNIP00000011133 ENSTNIP00000011133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]