SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011172 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011172
Domain Number 1 Region: 1232-1370
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-49
Family Phosphotyrosine-binding domain (PTB) 0.00000149
Further Details:      
 
Domain Number 2 Region: 299-425
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.41e-38
Family PLC-like (P variant) 0.0034
Further Details:      
 
Domain Number 3 Region: 132-296
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-30
Family Dual specificity phosphatase-like 0.00022
Further Details:      
 
Domain Number 4 Region: 1094-1218
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-20
Family SH2 domain 0.0023
Further Details:      
 
Domain Number 5 Region: 24-82
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000434
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011172   Gene: ENSTNIG00000008342   Transcript: ENSTNIT00000011354
Sequence length 1373
Comment pep:known_by_projection chromosome:TETRAODON8:3:1839603:1871449:-1 gene:ENSTNIG00000008342 transcript:ENSTNIT00000011354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKVSRERQKPLRFIHHLSSSRFFTQPDELEGVHTHTFKLKPFKKAKSCDICKQAITKEGL
ICKACRLSCHKKCEVKVTTSCQTSTNHEQPRNTAMSLIEVDVCNKLLQHLVKKNHLNTSQ
SVVLTMEENHEVDLVYITERIISLCFPFGMEEQGYIANLTEVATMLRSKHGEHYLVLNLS
EWRSELPKLNHKVLEFGWPDLHAPALDKICSMCKAIDTWLNGDSRNVVVLHNKGNRGRTG
VVVAAYMHYSNISASADQALDRFAMRRFYEDKALPVGQPSQKRYVRYFNGLLSGHIKINN
KPLFLHHVIMHGIPNFESKTGCRPFLKIYQAMQPVYTSGIYNVQGDSNTSICITIEPGLL
LKGDILLKCYHKRYRGPTRDVVFRVQFHTCAIHDLGVVFGKSELDETFKDERFPEYGKVE
FVFSYSPEKIRGLDHLENGPSVSVDYNTQENLIRCDSYDNFNQRSEDVVDGEHELAHTQG
PLDGSLYARQPNRPPANTQPSDRPTWPHPPVQEVASDTWSQHRCTLTGATQGYSPSPQRR
SGTGIHRQAAPKGTLNLASGTRWRGRDAKLGGPGGSSHCRFVMGAHSRGRPAAIKLALPQ
SCRQWRRDESGSGVRSRGMTPEVTQEAGRRRTTSEGQYQSSRDSTAMVDSPDFTRSLALN
PGGRPREVSLKNLSTTGRRLKTARWIASCTVPPLEAVVRIPPRPSASPCRHRLLTSTCVG
WLCQNQHSSLYLLTPGLVLTRLAVHPQPFPREEMQTDPNGLCDVGFEQCCTDEHHFGFRQ
QAGEVTVMLSAVLDSFLPSLPLCHHDGFICSGLVSLSAARSPPGLAKTPLSALELKNHQQ
GGSGPLLKHRSFLFPLTLLKNILFENHRLRCTLCFLTLLSPDNHMSGDSRAQAFCSPFTS
AYPGHSSDGRRSASSGAHSPAHSYPHRPASPEGSQVNVMGVHMVPGSPNTLHRTVATNTP
PSPALQRRLGQASPSLARHQQGPNRDNVPSSPLIGRNPKTAAAGVPPSPLMGRRTAMSGR
STPDDIGPQPLTPAFPVSPQLPEKRHMSTGDVERTDNKNLMAGGGSSAPNLSGTHTSTDV
PKSIYDIKMNVKFVQDTSKFWYKPDISREQAINLLKDREPGAFIIRDSHSFRGAYGLAMK
VACPPPTVPQNKKVGDLTNELVRHFLIETSAKGVRLKGCPNEPYFGVVGCLSALVYQHSM
TPLALPCKLMIPTKDPNEEALELATPTDSVVELLKQGAACNVLYINSVDMESLTGPQAIA
KAISLTLETNPLPAATTVHFKVSMQGVTLTDSQRKLFFRRHYPINTITFCDTDPQNRKWG
KEGGGSVKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIASFVSKMMKRKKK
Download sequence
Identical sequences H3CSD8
ENSTNIP00000011172 99883.ENSTNIP00000011172 ENSTNIP00000011172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]