SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011203 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011203
Domain Number 1 Region: 112-240
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-26
Family Cadherin 0.00063
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-26
Family Cadherin 0.00044
Further Details:      
 
Domain Number 3 Region: 719-840
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-22
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 887-1034
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.97e-20
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 5 Region: 250-356
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000914
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 332-443
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000328
Family Cadherin 0.0082
Further Details:      
 
Domain Number 7 Region: 439-539
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000514
Family Cadherin 0.012
Further Details:      
 
Domain Number 8 Region: 1079-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000359
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011203
Domain Number - Region: 1040-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00683
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 870-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011203   Gene: ENSTNIG00000008369   Transcript: ENSTNIT00000011385
Sequence length 1383
Comment pep:novel chromosome:TETRAODON8:13:7006241:7037733:1 gene:ENSTNIG00000008369 transcript:ENSTNIT00000011385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVNDNVPFFTSSIYEASVTEGAQIGTSVLQVSAHDKDLGLNGQITYTLLSDSSGDHSLFR
IDPELGIIYTEAVFDREARSSYLLEVQSEDGQESARPGKNKQPNSDTAYVRVFISDVNDN
KPVFAQRLYEVGVDEDADVGLAVVTVSATDEDEAGANAKLRYQITSGNKGGVFDIEPEVG
TIFVAQPLDYEQQKRYKLLVLASDGRWEDYAAIVVTVVNKNDEAPVFSMNEYYGSVTEEL
DGSPVFVLQIDDENDNAPEFASSSHLLPPLPEDVPVGTSIIQVVATDTDSGLNGEILYSI
LPQSDPHGHFATAGTPALTASVTVHLLLLDTNDNGPELETAYAPVLWENSPAPQVVWLNQ
SSTLLHVVDRDSPENGPPYYLSLPSLYSVDFHLQDHGNGSAMLTALRMFDRERQSEFHLP
VIMVDSGDPPMTATNTLTITIGDQNDNAHQAGEKDVYVHSRKGRVGNAALGKVYAPDPDD
WDNKTYTLETSAAKYFSLNQSSGELTIRQNAPAGSYWLRVGVSDGVWPDVISGIRVHVRD
LEEKAVLSSASLRLTGLTARDFIDSRIEGKSRLETFWDFLSETLSVRTGSINIFSVADRE
QKTVDVHFYVLAENGYLHPEKLHAVLAAHKRKLQSLLRVNVSQVEVDECVHADCRASGGC
FTQLSVSNSPSLLDSGALSLVSVKVTPVAVCGCAAREMTYRICASYPGNPCLNGGTCMDT
KNGYRCHCPPQFDGPDCQQTRLSFLGNGYAWLPPIRPCFDSHLSLEFMTDEDDGLLLYAG
PLATLLPGDTEDYMAIELIGGTPSLKMNHGSGTLVLQLNHNIGVANGRWHRLDVRSNSKL
YDLGSPAEASNTVPGCTLIDGHCTDGEPRPPCGLRGHCHSHWGSYSCLCQPGFTGPQCDR
VQQSSPVLSQVIQGLLAVFYNLGDGDYNLTLPHQHLSDGEWHELELDRYGREFTLRLDGG
GGRREVTASRGQGQEIVVDPTTVMLGNSFPSGHNHSFLGCMRDLRFNGHSIPLDPEQTSD
RLQVVAVQGVSPGCSSEACRQHQCSPPLVCVDLWRHHECRCPPGHITRETTQGKVCMYTL
CASRPCRHGTCVAHSPSRYSCHCSEGYRGRHCEVTLAMFHNEDNNSLSLSSMFAISICVM
AFLVLMLGLFLYSCWRRHKGLKEGVYHVSAHHGEWEDIRENVLNYDEEGGGEQDQNAFNM
VELQRSLQPSPAQSLRYSYPHSIISYPQTKPPKNNSKKVPTNWNGSSAIALRLAIPPSET
ETLPSPLTFRRSQKSFSFSSQDLALYLCEVIRDMEHPQQLGTMTTPRRTSGKERRLAAVR
SLSSLSASQGSEARPQATQGTRLDRLKTLRAVVGDLRGESKTPESQKDKLKESKGQLNCE
KSG
Download sequence
Identical sequences H3CSG9
ENSTNIP00000011203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]