SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011205 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011205
Domain Number 1 Region: 17-128
Classification Level Classification E-value
Superfamily Prefoldin 4.18e-20
Family Prefoldin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011205   Gene: ENSTNIG00000008371   Transcript: ENSTNIT00000011387
Sequence length 497
Comment pep:known_by_projection chromosome:TETRAODON8:13:7127585:7132665:-1 gene:ENSTNIG00000008371 transcript:ENSTNIT00000011387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMTMAEKDHTNIDNLDGVVRLRKEQEKVVKDCETKIQHWKKVSDDYEALNERLQTLPDQL
SYDIMVPFGSLAFMPGKLVHTNEITVLLGDNWFAKCSAKQAQKLVAHRMEHVKKELDDLS
KTRNNFAARVEFAKKMETATAMKGDFVDIREVENNDAVVTKEGTRRIAHRPNSKPKLDAV
LDLKKEDEEGDDGGGGKGILTEEELWARLDELEKLEALQDERDRLSDNADMNGEDTSSLS
SEEEKDGARPVNEQSLKPSWMSLPQSQAPASADSNDGGEGSCLPTIFFSHTVEPKKVRIN
TGKNTTLKFSERKEQKEHSKRKKKNGHSNGHAHHELHKITTPADIYRLFVDVRNGELFPR
KSILKSRSRENSVCSDTSESSAADFEERRVMGRGLSHEDATHSDTSDGITEEDSPGAAPT
PTPMHAHAHTASRFEAFSGTVVEKDPMPLTVPHLTIAPPALPTILERKQEEVAPDAPPPQ
QAPKRVSKFKAARLHQN
Download sequence
Identical sequences H3CSH1
99883.ENSTNIP00000011205 ENSTNIP00000011205 ENSTNIP00000011205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]