SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011209 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011209
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.87e-64
Family FCH domain 0.0013
Further Details:      
 
Domain Number 2 Region: 479-671
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.35e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000814
Further Details:      
 
Domain Number 3 Region: 722-779
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011209   Gene: ENSTNIG00000008375   Transcript: ENSTNIT00000011391
Sequence length 829
Comment pep:known_by_projection chromosome:TETRAODON8:13:7159791:7193186:1 gene:ENSTNIG00000008375 transcript:ENSTNIT00000011391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIRAQLVEQQKCLDQQTDMRVQLLQDLQDFFRKKSEIEMEYSRNLEKLAERFMAKTRSTK
DHQQYKRDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRLLKK
SKEIAFQLQEDLMKVLNELYTVMKTYHMYHSESISAESKLKEAEKQEEKQIGRGDQVFSI
RMEDKYQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEASNSSLFKYYIHDLS
DLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDSLDPRNDRQRFMEMYP
TAFCPPAKFEFQSHMGDEVCQISLQPPVNGELILRFQQLQSRLATLKIENEEIKKTSEAT
LTTIQDMVTIDDYDVSECFHHSRSTESVRSTVSETYLSKPSIAKRRANQQETEQFYFMKF
REYLEGSNLISKLQAKHDLLKRTLGESHRADYMTTRPFMYLKNHTGTRRPRPRSVFNVRL
FNGNLESFIKDSGQAIPRVVESCIRYINLYGLQHQGIFRVSGSQLEVNDIKNSFERGNDP
LTDDESNHDINSVAGVLKLYFRGLENPLFPKERFNDLLACIRIENLYDRALYIRKILLTI
PRSVLVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPTPESQDQVSCQAHVNEII
KTIIIHHESIFPDAKELDGPIYEKCMAGGDYCESPFSEHGALEEVENEGGTEAHTSEDEG
EPIEAIAKFDYVGRSSRELSFKKGASLLLYQRASEDWWEGRHNGIDGLVPHQYIVVQDVD
DNFSDTLSQKADSEASSGHTGEDRCSGKDMASPTDTRISEAYITRLVGS
Download sequence
Identical sequences H3CSH5
ENSTNIP00000011209 99883.ENSTNIP00000011209 ENSTNIP00000011209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]