SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011211 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011211
Domain Number 1 Region: 441-618
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.38e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 301-398
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000137
Family WWE domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011211
Domain Number - Region: 106-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00968
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 24-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0811
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011211   Gene: ENSTNIG00000008377   Transcript: ENSTNIT00000011393
Sequence length 618
Comment pep:known_by_projection chromosome:TETRAODON8:13:7200260:7203160:1 gene:ENSTNIG00000008377 transcript:ENSTNIT00000011393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVAKTRLRLCSAKAGQCSQCSQLHLCRFVVCGQCRFGNSCKNSHSLSSGKNQEILKSQG
LQDLTERQLFQLLLQNNPRLLPEVCPHYNKGDGLHGSCKFSTSCTKLHICQHFLQGDCAF
GTSCKRAHHFHVNKQLFQCFSCENVENLFQIYRNKFIIEGQGERRASEFPGRLLPPAVPQ
TLGGATRRPLSSKPKPASAPKPASDADKNEICLFFIRKNCSFKEKCARVHWHLPYRWQVS
DSDGVTWTDLPDMEEIERAYCDPRQENSSTEHSEATTSQSAVDFLTMTFKSRPVRRLSTA
SSVSKPPHFILTTEWLWYWRNDTGQWLEFGQVRQKDADAQASITPSMLEKLYWADRDGEV
PFCAGNQQYILHFAGEETQMYQQNLKYQTKRKIRRRPRFVSADEVAIKLKSAASPSAGSS
TAESLPQYWDKNDHPGCDYKLIQLSKSAEYNRIETLFKRTMPNSTIHQIQRIQNPSLWRV
FEWQKEQMTKKNEGKSVNQLYLFHGTDESLVEAICEQNFDWRVCGTHGTVYGKGSYFAKD
ASYSDQYSRISSRRNKIMFVALVLVGDSTQGRSSYVRPPPKGNSKAFYDSCVNSESNPSI
YVIFEKQQIYPEYLINYS
Download sequence
Identical sequences H3CSH7
ENSTNIP00000011211 99883.ENSTNIP00000011211 ENSTNIP00000011211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]