SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011221 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011221
Domain Number 1 Region: 488-655
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.7e-70
Family A middle domain of Talin 1 0.000000288
Further Details:      
 
Domain Number 2 Region: 755-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-51
Family I/LWEQ domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 2297-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.38e-49
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 660-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-47
Family I/LWEQ domain 0.00000522
Further Details:      
 
Domain Number 5 Region: 1842-1975
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.76e-44
Family VBS domain 0.00000997
Further Details:      
 
Domain Number 6 Region: 1227-1365
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.67e-39
Family VBS domain 0.026
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-31
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1076-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-28
Family VBS domain 0.01
Further Details:      
 
Domain Number 9 Region: 312-398
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-19
Family Third domain of FERM 0.0000228
Further Details:      
 
Domain Number 10 Region: 1473-1559
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000824
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 1698-1818
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000204
Family VBS domain 0.035
Further Details:      
 
Domain Number 12 Region: 2007-2134
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000863
Family VBS domain 0.025
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000756
Family Ubiquitin-related 0.048
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011221
Domain Number - Region: 1592-1663
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000235
Family VBS domain 0.046
Further Details:      
 
Domain Number - Region: 946-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00294
Family I/LWEQ domain 0.005
Further Details:      
 
Domain Number - Region: 2137-2233,2260-2292
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00863
Family I/LWEQ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011221   Gene: ENSTNIG00000011353   Transcript: ENSTNIT00000011403
Sequence length 2546
Comment pep:known_by_projection chromosome:TETRAODON8:5:2568231:2595427:-1 gene:ENSTNIG00000011353 transcript:ENSTNIT00000011403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDHGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAIKTIMLDDSKTVGELLVTICSR
IGITNYEEYSLIQETVEEKKEDGMGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
GGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDERTKDVVQEWPLTTVK
RWAASPKDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLE
ESVSPKKRSTILQQQFNRVGRVEHGSVALPGVIRSGSIGTESLSMGTMPCAQQQITMGQM
HRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLDEVDNLPPLGQDMASKVWIQNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALMED
DVGGGNDLMRAARTLAGAVSDLLKAVEPASGEQQPRQTVLTAAGSIGQASGDLLRQIGEN
ETDERFQDILMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVA
CAKQVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELLKQVSAAASVVGQA
LEDLLQHVRQYTARGEPIGRYDQATDTIMTVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKA
VADHIPQLVQGVRSSQASPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAM
QLGQCAKNLATCLAELRTSAQKAHEACGPMEIDSALTAIQTLRSELQDAKMAAVNTQLKP
LPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHYTGIAARETAQALKTLAQAARGV
AASTTDPKAAAAMLDSARDVMEGSALLIEEAKQALVSPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDMALKSIGEASKKLLIETIPPASKSFQEAQNELNHTAEELNQSAGEVVH
ASRGPSSQLAVASGKFSEDFDEFLDAGLEMAGHTQKKDDQVQVIGSLKNISMASSKLLLA
AKSLSVDPAAANAKNLLAAAARFRAVTDSINQLITLCTQQAPGQKECDNALRELEAVRGM
LDHPNEPVSDLSYFDCIESVMENSKVLGESMAGISMNCKNGDVAAFGDCVGSASRALCGL
TEAAGQAAYLVGVSDPNSQAGHQGLVDPVQFAKANQAIQMACQNLVDPESSPSQVLSAAT
IVAKHTSALCNACRLASSKTTNPAAKRHFVQSAKEVANSTANLVKTIKALDGDFSDENRN
SCRVATAPLIEAVENLAIFASNPEFASVPAQISREGRTAQEPILQSACSMLDSSTHLLKT
ARSLVINPKDPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDSSIDNINKCIRDIE
QASLAAVSQNLPSRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVTQLAG
YFEPLIKASVGVASKLKDHQQQMTFLDQTKTMAESALQMLYAAKEGGGNPKAFHTHDAIA
EAAMLMREAVDDIMVTLNEAASEVGMVGMVDSITEAMAKLDEGTPSAPEGSFVDYQTSMV
KHSKAIAVTAQEMITKSVTCPDELGALASQVTGDYSQLAVQGRLAAHTAEPEEIGFQIKT
RVQDLGHGCIFLVQKAGALQITPSDSFTKRELIDCARVVTEKVSLVLSALQAGNKGTQAC
ITAANAVSGIIADLDTTIMFASAGTLNAENEESFADHRENILKTAKALVEDTKMLVSGAA
SGQDKLSQAAQSSAKTITQLTDVVKLGATSIGSDDPETQVVLINAVKDVAKALAELISAT
KCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELA
LFQSKDPPTKTTTPEEFIRMTKGITTATAKAVAAGNSARQEDIIHTANLSRKAMSDMLST
CKQAAYHPDVSEEVKNRALMFGSQCATGYIDLLEHVLLVLQKPSAEFKQQLAVCSKRVAG
AVTELIQTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADET
LNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGLISANAEDDGQWSQGLISAAR
MVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQQ
IAGNAVKKASDNLVRAAQNAAFNKADDDNVVVKTKFVGGIAQIIAAQEEMLRKERELEEA
RKKLAQIRQQQYKFLPSELREDNNDK
Download sequence
Identical sequences H3CSI7
ENSTNIP00000011221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]