SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011250 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011250
Domain Number 1 Region: 1-364
Classification Level Classification E-value
Superfamily Sema domain 8.24e-101
Family Sema domain 0.00000146
Further Details:      
 
Domain Number 2 Region: 366-399
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000262
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 425-484
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000155
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011250   Gene: ENSTNIG00000008415   Transcript: ENSTNIT00000011432
Sequence length 538
Comment pep:known_by_projection chromosome:TETRAODON8:13:7846978:7852066:1 gene:ENSTNIG00000008415 transcript:ENSTNIT00000011432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNVITVIEKFQDSLFVCGTNGQKPRCWKLYSSVNNQPHEIMESYEGMGISPLMHTQNSI
SLTVEEDLYAAAPLDTEGRHLLFRRKGGSRTNVWMYDSWVSEPTFISASWVQRQNDPDNE
KIYIFFREKNSDTNPEADPWISRVARVCKVDEGGSKRFFQNIWTSFLKARLVCGFPEESL
YFNRLQDTFVMHADDWHDTRIYALFTSSWNSTAVCVYSIDTIEEVFENSTFRGYHNAVPT
PRPGTCNRNSRSLPLATINLVKNHPEMSDWVHSVHYTAPFYVSNNNYVKIAVDRVQAADQ
CMYNVLLLSTDSGKIHKVLEADSKPFVISQTQLSSRSPVQSIQLDAKRKRLVVGFSEKIS
AVELQRCQDYNSSCEKCVLARDPYCAWTDSGCSPHVLRRSILEQKQLVRTRREADSGSAE
GLGTSHSVPLGVPFYLSCPIDSYHAVYTWRHKGQTSPCLQMQSNCLHLIPVMTEDMYGKY
TCVSQEKGYTNEVKSYHLTQHNPNSLRDLQGFENDASAVVPQLWVSLGCYLSCYSIVH
Download sequence
Identical sequences H3CSL6
ENSTNIP00000011250 99883.ENSTNIP00000011250 ENSTNIP00000011250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]