SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011282 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011282
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily PX domain 1.19e-17
Family PX domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011282   Gene: ENSTNIG00000008446   Transcript: ENSTNIT00000011464
Sequence length 179
Comment pep:known_by_projection chromosome:TETRAODON8:13:8429522:8432064:-1 gene:ENSTNIG00000008446 transcript:ENSTNIT00000011464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEVSIPSMEREVDDSGKSKKLFRVEVLFNERKHFVLRRTGEFQALHRKLKKIVQTPDFP
SKRSPHLRTKPLKQRRQELEDYIQEIIYHNEDVPQVLLDFLHVKHFHTRMSSIESLDNLD
SQDDGLQFPQRRVLGYFQDPFMTDCTTELPDVVVDGVLQGFYPRDIRVSFSPSLKPSPL
Download sequence
Identical sequences H3CSP8
99883.ENSTNIP00000011282 ENSTNIP00000011282 ENSTNIP00000011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]