SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011305 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011305
Domain Number 1 Region: 38-203
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-46
Family Ankyrin repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011305   Gene: ENSTNIG00000008469   Transcript: ENSTNIT00000011487
Sequence length 1671
Comment pep:known_by_projection chromosome:TETRAODON8:13:8987730:9003416:-1 gene:ENSTNIG00000008469 transcript:ENSTNIT00000011487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFFSLTKKKKRSSGTPDSGSVLSGGYELKDKDLGKVHKAAAVGDVGKLKELAEKHDIN
QLDKENRTALHIACASGHVEVVHFLLERKARLNLCDNQNRSALMKAVQCQHERCVRLLLE
NDADPNLVDIDDNTALHLAASIPSISTAVLLLKHDADIDAQNKDGLTPLAMAVREDHIDM
AEFLLKEGADVNIVDKDQRCSLLISEHSIKRKKTHSPSLAGSNSEDNSQSESQSRDIESV
GDDWPSSEDDSLLSEAVCAPKPQKANLMKMLATKRKEVSALPDRTLKDTKTDPDSENNVQ
PTIIPPKEHPLDPSPSFLPSKAPRLTPTSPSNSKKSSYVSGDTESGEVAAVEQTTNDNTA
FENCDSRRNRADHFLPQTDIDDVELDSSDESVVERRNEVRNPEGPVTQVKQENVSTFSCS
YVLYVPSFIRGGGLSRMDMLEPWRRIGMPRGSQGEARKMVLQMKETVEGEKSVYKDGLQV
QDRLTSLSSRHQVPDQVTEEEQRASSSNYTREQKEDSRPGVSGVTKTHEDVNWKHNSTNT
NKAPNDLESDDNDSASLSEEESTKPDALSSQAKQQPHLTERLPVQMQQELSKDGNKEEKQ
SEMSPTAPHHRACQQNIHIEDPLSLYDDDCLDGISDEGARFSANGRETRELPEHAEVAED
LAELTHSSDSSIEDMESPLSEQTALLIQKLNSTLSTDSSVIIELQNIIYKYHHSIQKEKY
RSANLVNKVSYLEMEKAELKSSLEEVKSDKTGLELNQLELQAEVRNLKLQLKQEHEDHCK
STREKLRVMEEQQQFEVQERDKVEFTLRNLELENTKLVNNLKQLEEDYSEIQKLLAQERS
ARIQQETLFNNCLRKQQETEEENKQNISKSNEASSREREMLLQIATLQEQLTTSKRDLEH
SCANSSLRECTLSEENRVLKDQLEDARRDLKLNSESLKNTVFNSNNEVSSLKSELSETRT
RLENERYTCERLETELESIRTRLSGAEKEAERSHVAKSERESTLLREKEEHQHLKGKLTG
EVAILREENSTLSQKLIKAEAQANNLENEAHRVTQQLKDKGLLQEVLQREKEQAVTRGLE
LEKTLHAEREQFSRDRARHEATQERLTQAQSEVMLLRQQLEEAQNKGLAKERAVTDAQGH
LKDILSKLQSDYEERVQLVKERNKELDSKANDLQDHIHKLQDEKNEIKTSLRQAQQELAD
SLKKLSMSEASLEVNTRYRNDLEEEKTRLSKDMDRLKKKKLQESLSTTAAYETTIKQLEQ
DMQRLEIENARLEATANKQSKEINTLQKGTHEAALMEAEKNKAVQLEEQKKATDIRLDLE
LTRNTELQKEMYRLRTLLKTAKKKLKEQDRSGTEFGSSGPVNNKVIICPFLIYKMTSQVD
WMQLQLEQEASLRRQLEKVNEELKDQLASVKSTSLKRDQLDMRKKQLEEEVLHLFFSIFL
NVIFYYVALYRRNADERARQELQVKLDQVNLFLQTQAASQEVLEQKKANREANLRFQLEQ
RIIELEADLRRARDSLRSTRTELERYQKLYTDELQLHKSLNDQLERATFQLKESNSTLLN
ERNKSFASSVLDLDSLGSLSYGDTKGRGVSLGLPLLSPATEGQSSRVGDFISKMQTELER
SISTEIKNATAELENASARLSPVGSVSRADLHPVSMARQQYLEVLKKNNMI
Download sequence
Identical sequences H3CSS1
ENSTNIP00000011305 ENSTNIP00000011305 99883.ENSTNIP00000011305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]