SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011335 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011335
Domain Number 1 Region: 71-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.84e-53
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 417-459
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000301
Family SOCS box-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011335   Gene: ENSTNIG00000008497   Transcript: ENSTNIT00000011517
Sequence length 466
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:911579:914940:-1 gene:ENSTNIG00000008497 transcript:ENSTNIT00000011517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSFVFTSMALRSLQQDEDMLQRYECRRRLASWHLSTSYMLKKEVTDGTPQRSGTSLP
AAVCQDAVVQNALYTGNLEVLQELFPRGSRVRLIIEPRGGDMRWVATGEGLWSLSYEQEL
TTPLHITASRGFTECLRLLLQRGADVELAPGGITALHESCENCQPECTKLLLSHGANANA
VSEDGYMPLHYCTQPESLECAKYLLQYGAAVSGCSSDEGDTPLHVAARNGLPDHVELYLR
YGASVDKLNTEGLTPLNACCSQHQEVGDLQRYFKVCQTLLRAGADVHVADQDRRSPLHMS
CKNANPDIVDALLANGACVNDMDYGGEAPMHNILKVVCYKVLHQPERIVPALLDHGSIRV
WPGALPKVLKHCSMSPRTIEVLLNAYSHLKVTDTWVESVPPEVQKEHKEFYDSIFSLAMT
PRSLQHLARCKLRDLLQGRVHKVVPKLALPTFIKNYLLLEYRGYVH
Download sequence
Identical sequences H3CSV1
99883.ENSTNIP00000011335 ENSTNIP00000011335 ENSTNIP00000011335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]