SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011338 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011338
Domain Number 1 Region: 553-665
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00039
Further Details:      
 
Domain Number 2 Region: 14-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.6e-28
Family G proteins 0.00000656
Further Details:      
 
Domain Number 3 Region: 677-769
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 287-354,493-538
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000201
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011338   Gene: ENSTNIG00000008499   Transcript: ENSTNIT00000011520
Sequence length 800
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:857808:901229:1 gene:ENSTNIG00000008499 transcript:ENSTNIT00000011520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD
GQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEVPMV
LVGTQDAISAANPRVIDDSRAKKLPNDLKRCTYYECSTYGLNVERVFHDGEHGVVKVVHL
NRGWILLLSSVPRHGDAEARHLPSVGAGVASRAGVSAHDLLRSSEPRVGSGRVSQTRSDT
ITHTQTPVSAHSDIPHKNTLYRSHEGNHGKASEQAKSVDSKTDSIGSGRAIPIKQGILLK
RSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKIPGKRPPRAVA
TVAPTASPKTNGLAKDRSGLQLGIGNTGASHSNSSTSLQTGGLVFGGSKDGMHQRSFSVS
SADQWNEAINTSTSSGAPNGTSDPAGSSAGSATSPKLEPPPSPHANRKKHRRKKSTGITK
PDGLSAGNEEQEDSFEFVIVSLTGQTWNFEASTYEEREFWVQAIESQIFASLQSCESIKN
KSRLGSQSDAMAIQSIRNVRGNSFCVDCDAANPDWASLNLGALMCIECSGIHRNLGTHLS
RVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALENYNKPGNDSTREEKERWIRAKYDQK
LFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAM
ANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGSQECADILLQHGCPNDSSSATLTLAP
NASLRNANPNINNNNAQCEL
Download sequence
Identical sequences H3CSV4
ENSTNIP00000011338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]