SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011355
Domain Number 1 Region: 87-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-17
Family Ankyrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011355   Gene: ENSTNIG00000008515   Transcript: ENSTNIT00000011537
Sequence length 518
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:556182:559844:1 gene:ENSTNIG00000008515 transcript:ENSTNIT00000011537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGEKIRAMRKEHPKANKNEEIMDAYEEPSNGTVPNGTGNHFRSNKAFLKASARQQQQLN
SNNINGNSSGGCDANKNPIILSSDGRDFPVHECVFKGDVRRLSSLIRTHSITQKDAHGNT
PLHLAVMLGHKECALLLLAHNAPVKIKNSQGWSPLAEAISYGDRQMITAILRKLKQQSRE
SVEDKRPRLLKALRELGDFYLELHWDFQSWVPLLSRILPSDTCKIYKQGINIRLDTTLID
FTDMKCQRGDLSFIFNGDAPPSQSFVVLDNEAKVYQRIHHETTKESEMETEEEVDILMSS
DVYSATLSTKSITFSRSQIGWLFREDKTERVGNFLADFYSVNGLVLESRKRREHLSEEDI
LRNKAIMESLSKGGSISEHNFEPVRRQSLTAPAPNTISWEEYITAEAGKPPHLGRELVCK
ESKKYFKATVAMSQDFPLGIESLLNVLEVVAPFKHFNKLREFVQMKLPPGFPVKLDIPVF
PTITATVTFQEFHYDEFEESIFFIPEKYKEDPSRFPDL
Download sequence
Identical sequences H3CSX1
99883.ENSTNIP00000011355 ENSTNIP00000011355 ENSTNIP00000011355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]