SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011364 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011364
Domain Number 1 Region: 395-562
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.29e-65
Family MgsA/YrvN C-terminal domain-like 0.0000144
Further Details:      
 
Domain Number 2 Region: 126-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.66e-43
Family Extended AAA-ATPase domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011364   Gene: ENSTNIG00000008524   Transcript: ENSTNIT00000011546
Sequence length 566
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:398346:401250:1 gene:ENSTNIG00000008524 transcript:ENSTNIT00000011546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLALAIMATNMKSASPASVQCPVCFNDFTPMTINLHLDACLLEKNTCSKPSKTAESEPPL
KKHCVNLETKPSVPLANSTASGSSYVAGSQPSGMFSVFQTDKSTVSPQNGNGGQLKGKHF
FNKGTKGKPLADILRPDTLEEYFGQNKVIGQQTLLRSLLESEEIPSFILWGPPGCGKTTL
AHIIAGKCKRKGTARFVTLSATSASVSDVREVIKQAQNELRLCKRKTVLFIDEIHRFNKS
QQDTFLPHVECGTVILIGATTENPSFQVNTALLSRCRVLVLEKLSVEAMASILDRALAAL
GIRVLDQDSTNSSNGDQAVGQDVFIERKGLWTPLAYLCDGDARTGLNSLQLAVQAQVSAS
KADTSGRSASKEILVKEEHIKEGLQRSHILYDKAGEEHYNCISALHKSMRGSDENASLYW
LGRMLEGGEDPIYVARRMVRFASEDVGLADPAALSQAVSAFQACHFIGMPECEVILAQCA
IYLARAPKSIEVYQAYANVKACLRNHKGPLPSVPLHLRNAPTRLMKDLGYSKGYKYNPSF
SGPVEQEYLPQELQGVNFFTWSPAKS
Download sequence
Identical sequences H3CSY0
ENSTNIP00000011364 99883.ENSTNIP00000011364 ENSTNIP00000003162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]