SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011410 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011410
Domain Number 1 Region: 394-572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-53
Family SPRY domain 0.00041
Further Details:      
 
Domain Number 2 Region: 140-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.87e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 8-61
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000565
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011410
Domain Number - Region: 179-307
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00324
Family FCH domain 0.033
Further Details:      
 
Domain Number - Region: 328-412
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0667
Family FAT domain of focal adhesion kinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011410   Gene: ENSTNIG00000008570   Transcript: ENSTNIT00000011592
Sequence length 574
Comment pep:known_by_projection chromosome:TETRAODON8:7:2332666:2336691:1 gene:ENSTNIG00000008570 transcript:ENSTNIT00000011592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVASMSSDQESCYLCKEHLRDPVSIPCGHVFCSICLKTYWDHAEHTGSFLCPQCRVTYNK
RPTPRRLGGSRYSTMPRDSFPPPPPSPDYNHAGPQDVGCDICIGKKYKAVKTCLMCLASY
CEKHLKPHFESATFKRHKLVDEIGHLDRQICPQHQKGLELYCRTDQMCICVLCTVKEHKG
HDMVSAEQERAEEQQRLGTTQAEIQEKIHDRLKQMEELKQAVDALKNSAQRALQECEKTF
SDMIRSIERMQQEMAKLISSNKRAALNNAEGHVERLSHEISDLKRRDTEITQLSRTEDHI
HFIQSYHMLIAQTEAEELPTVSVNPYFTFGPVTKAVSEMKQHLNEFSNDELVKVAKAVNK
MTFCQLDESKKRLSIKGEEAPMYKSVPVQEPQYREDFLRYACQLTLDPNTAYRQLYLSRG
NRKAALKRDPQAYHDSSARFDSLPQVLCVEPLSGGAYYWEVDWSGEGAAIGVTYKGIKRA
GYGDACRIGYNRKSWSVFCSDSSYSARHNKDQLEITAPYSSRIGVFLDHAGGTLSFYAVG
ETMSLIHRFKASFSEPVYPGFWVWYESAITIIQL
Download sequence
Identical sequences H3CT26
ENSTNIP00000011410 99883.ENSTNIP00000011410 ENSTNIP00000011410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]