SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011411 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011411
Domain Number 1 Region: 398-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-55
Family SPRY domain 0.00034
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-19
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 143-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-16
Family B-box zinc-binding domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011411
Domain Number - Region: 207-292
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000798
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 
Domain Number - Region: 268-348
Classification Level Classification E-value
Superfamily Prefoldin 0.0968
Family Prefoldin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011411   Gene: ENSTNIG00000008571   Transcript: ENSTNIT00000011593
Sequence length 576
Comment pep:known_by_projection chromosome:TETRAODON8:7:2325966:2329441:-1 gene:ENSTNIG00000008571 transcript:ENSTNIT00000011593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRTSPDYFSCTLCLSLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNANATQDGGYAGAADVPCDFCMGKKLKAVKSCLNCL
ASYCEKHLKPHYESATFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERSDKQQKLLGISQAEIGTKCQERVKELEELKTAVDSLKNSAQRAMVES
QKMFEDMIRSIDRMKTEVTKLIGINEKAAFKQAEALMERLEQEIDELKKKESGLKQLYST
EDHIHFLQNFNYLCTPTDDGFIPRVSVNPDFSFAAVRKAVAEIKERLEEFGREELVKISK
SVSEIPVYTTESRTLDRRSRGLAKEVTTDHISPEPKARSEFLKYFCQLKLDPNTAYKELY
ISENSRKVIRTRDLQPYGDNSERFDSFAQVLCREALSRGRFYWEIEWNGEFSIGVAYRSI
SRKGKGSMCLLGYNDKSWSLLCSDTGYSAWHNRVDKNISAPHSPRIGVYLDHGAGVLAFY
SISSSMTLLHRFETTFTEPLYPGFGVGTSVKICNLK
Download sequence
Identical sequences H3CT27
ENSTNIP00000011411 99883.ENSTNIP00000011411 ENSTNIP00000011411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]