SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011417 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011417
Domain Number 1 Region: 3-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011417   Gene: ENSTNIG00000008577   Transcript: ENSTNIT00000011599
Sequence length 331
Comment pep:known_by_projection chromosome:TETRAODON8:7:2296274:2298173:1 gene:ENSTNIG00000008577 transcript:ENSTNIT00000011599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGDNDCSLWATCTNTWASYTCACLEGFIDHQPERPGRACQGGEDTQGLCTQLTIQPSHRP
HPPPAVLHGATPDAPQTACAVPKGAISVQCRGAAITVSVARDFLLSASIGENSLYLGLQG
CGVNGGSSTHTQLTVGWSECDTRLVHNESHYMASVTLFNTVDQNVLPSGVTETPKIHLEV
PIMCAYEKSMLISADFGSTGYRYELFKDVIVGSGSFLVSVKLTNGTAPLPHNHSLSSDEV
VVVDVSLNTTLDQMKVVINRCWATPTQNPGDTYSYAFMENSCSLNAYTKVLTNGNSSTSR
VSVQIFSFVDLSVIYLHCQVQICVQIGSDSC
Download sequence
Identical sequences H3CT33
ENSTNIP00000011417 ENSTNIP00000011417 99883.ENSTNIP00000011417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]