SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011422 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011422
Domain Number 1 Region: 423-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.93e-74
Family Ankyrin repeat 0.0000131
Further Details:      
 
Domain Number 2 Region: 18-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-65
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011422   Gene: ENSTNIG00000008582   Transcript: ENSTNIT00000011604
Sequence length 713
Comment pep:known_by_projection chromosome:TETRAODON8:7:2264880:2269937:1 gene:ENSTNIG00000008582 transcript:ENSTNIT00000011604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSDSPPGTMGLLRTFDCSEFGSWEKIGSGGFGQVYKVRHVRWKTWLAIKCPPCLHVDD
KERSELLEEAKKMEAAKFRYILPVYGICGDPQGLVMEYMEMGSLENLLATELLPWELRFR
IIHETAVGMNFLHCMKPPLLHLDLKPANILLDAHYHVKISDFGLARWNGLSRADDISRDG
FCGTIAYLPPESIIEKDRVSDPKHDVYSFSIVIWGILTQKKPYQGENNILQIMVKVVKGV
RPDLGSIPRCRPPVCSGFLSLMQRCWATDPNARPSFQEITSEAEELYFKPQEEPKNTTES
APGPTPHKATTSDQKGMRPKSAMLPEKDCSLSELLTQVDSWISRSFDRLKENSCHSKEST
SKRLSGISFADSAFSSQDSITLSFEKENTFDSSEVQKRKLCDAIRTKDTAKLMKILQPQD
VDLLLDGGDSLLHHAVTLANEEAVKFLLLNNANPNLANARGSTVLHVATERHLKPTVELL
LGRRSTNVNAKDEDQYTALHWAAQNGDEAIARLLLDRGAAINETDGRGRTPAHIACQHGQ
ENVIRVLLSRGADVQIRGKDDWTALHLAAWQGHLGIVKLLVKQAGADVDGQTADGRTPLH
LASQRGQYRVARILIELGANVHMTSVGCTTLHVAAETGHTSTSRLLVKHRADVHAQSALG
LTPLHLASQRGHLATVKMLIEEGADPCRSGPGPCTPFQLAAENGHGEVLNELL
Download sequence
Identical sequences H3CT38
ENSTNIP00000011422 ENSTNIP00000011422 99883.ENSTNIP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]