SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011462 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011462
Domain Number 1 Region: 782-890
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 467-583
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 583-680
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 111-227
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 706-789
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 1004-1116
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 7 Region: 886-1000
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1104-1215
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 359-479
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000144
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 271-357
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000137
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011462   Gene: ENSTNIG00000008618   Transcript: ENSTNIT00000011644
Sequence length 1370
Comment pep:known_by_projection chromosome:TETRAODON8:17:6666763:6724063:1 gene:ENSTNIG00000008618 transcript:ENSTNIT00000011644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECKLSRPGPPATIVTIDEESPNGTVLVENMQINGRAQDPGRTISLTLLDNYDYWVILEPG
RQRLYLNSTGRVLDRDPPNYITTIVVQVQCTNELVGTVIFHEVRIVVRDKNDNTPRFQQP
RYYVAVNELTPVGTTIFTGFSGNNGATDIDDGPNGHIEYSILYNPNDPESNRTVSVGNTL
SGYIILAERLNYEERTRYLVVVQANDRAPYPPNRRTATTTLTVDVLDGDDLGPMFLPCVL
VNNTRDCNPLSYRAAIPEFTEPSKLNPLNVTPLIRAVDMDRNIQPPSDRPGILYYILVGH
PATYAEYFSLNKTTAELRVLQPINRDLYQRFTLIIKAEQDNGHPLPAFADLIIEILDENN
QAPYFQLATYQGYVSESSPVGATISASANLTTPLEIIALDNDIEETKDPLVKITLGDYTT
VFGVTQTGITRYLRLVTPVDREKQMTYTFTMVASDGVQQSSPVTVNILVIDANDNTPTFA
KVSYNVEVFTNMQPGETVLQLTAADADEGLNGLVTYEILAGAQGHFIINNRTGRLTVAPG
VALMVGQSYALTVKASDGAPETQRRSSITTVYIEVLPPNNQSPPRFPLLTYSLEVSEAMR
IGAILLNLQATDRENDPITYRIISGDTQQVFNLSETIGLLILRKPLDRERTDQYRLIVTA
SDGNPGGTSTTTVNIVVTDVNDASGKLVFYSHVRKKLQILLQVKMSMVILATDPDAGPNG
QIGYRIINHPDLFLISENGSIYTKVRLDRELQSHYDLVVEASDGAVDPRRTTLTLSIQVT
DIDDNSPVFSQQNYVVNVPENSPVGTVVLNLSATDADLVSNVTYRIRTDAARQLFSLNPI
TGELAVLQTLDFEDLAALGIGTSYSFQVEAVDQGGLMPPGQATVTVRITDMNDFSPVFSQ
DLYKGMVAPNAEKGTVITTVLAEDQDPPGTPASFVRYRVDLDRSPYSGSIFDVEKETGRI
VTKVNLNEEPSVTFKLFVVAFDDGEPVKTNSTLVEITVLQPSRIPIFTQEEYRFSPVSEL
APFDTPVGTVLAAAVNQTIFYSIVGGNDLGHFQINNKTGVISTAKPLDYEAVTSYVLRVQ
ADSMEVVMSNLRVPSKTNTAKVFIEVQDENDHSPVFSRKLYIGGVTEDTKIFSSVLKIVA
TDKDTGNYSMMAYRLIIPPTQEGQDSFVIETYTGIIKSAIMFRNMRRSYFKFQVIATDDY
GTGLSSSAEVVVSGLGRGSCHVINFNTPVKDCADFMFSILERHVQDQIPGAKVIVESIGP
RRHGDGFELEDYTKSDLMVYAIDPLTNRAISPKELFKFLDGNVLEINKEFQPYLGEGGRI
LEIRSPDIVASVKKAAQAVGYTEGALLALAIIIILCCIPAILIVMVTYKQ
Download sequence
Identical sequences H3CT78
ENSTNIP00000011462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]