SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011505 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011505
Domain Number 1 Region: 262-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 2 Region: 39-80,126-227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 223-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011505   Gene: ENSTNIG00000008657   Transcript: ENSTNIT00000011687
Sequence length 462
Comment pep:known_by_projection chromosome:TETRAODON8:17:5749766:5759957:1 gene:ENSTNIG00000008657 transcript:ENSTNIT00000011687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQCGCNVWIDMLGICVCLCVLLTHVLSLEPEDPISYTVKCTDGYKYDRIEDLCRDIDECA
LIDDACKGGMQCINHFGGYLCLPKNAYIFFDRDNDQQKVQNPAPPVDTIPRVVSSSETLY
QSTRSIRCTGGFTVDEQNFCRDIDECTTGRHTCGPEQTCYNTRGSYTCNCPLGYQRNGDH
CIDRNECSLTHYCMHACVNTQGSYYCDCNIGYKLDSNNHTCVDVNECDVQSPCQHLCINL
IGSFLCQCKQGYELATDAALLADIDECSFPSYTCQYQCVNTPGSYYCECPEGYQLQGNRL
CQDINECETGTHNCQDDEMCWNYYGGFRCYPRNPCEAPYTKTTESRCICRSQTECQGLPP
SIVYKYMSIQADRTAPADIFQIQATNIYANTHSTFRIKAGNAGGEFFLRRSGNASAMLVL
TKPLTGPREYVVDLEMVTHHLVMNYRSSSVLRLTIIVGPYAF
Download sequence
Identical sequences H3CTC1
ENSTNIP00000011505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]