SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011507 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011507
Domain Number 1 Region: 891-1013
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-26
Family Ankyrin repeat 0.000000254
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 812-836,1020-1080
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-16
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011507   Gene: ENSTNIG00000008659   Transcript: ENSTNIT00000011689
Sequence length 1089
Comment pep:known_by_projection chromosome:TETRAODON8:17:5707632:5718919:-1 gene:ENSTNIG00000008659 transcript:ENSTNIT00000011689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTVYLSNNDQHFTEVPITPETLCRDVVELCKEPGEADCHLSEMWRGSERAVGEGERMF
DLLQRWGQHRPEVRFFLRHNRAPSRELAAGSRASEPKRNGLKGPPDRRMENGVAPPRMDM
TLAELQEMAARQQQQIEAQQQLLASKEQRLRYLKQQEQRQQQQASEQEKLQRLRENIDNQ
ETRLKKVRALKGQVEQKRLSNGKLVEEIEQMNNLFQQKQRELVMAATKVEELNRQLELLK
TSKMEHFNDNQSSVAELDRLYKELQLRNKLNQDQNSKLQQQRENLNKRNLEIVSMDKRIS
ELRDRLWKKKAALQQKENLPLPSEGQAGQHTGPSRVAAVGPYIQSSTMPRGPVRQDQLVK
PVYPDGTATLPAHDPRSHPGPGAHLQSHDLNCQSWSCHFFSPSGTEESQAPDGCDVTLSS
EVDDSKLKGDRKVRPFSMFEPTEVPTTSLRKNQSSDDLVRDAQSAPKAPVKVPPPVPTKP
KGPTIVPYGKTGLNTGTFPKAKPHNQQPQSAQGRSPLPPSQSQTLPLPAKQDAPPAATVR
PFTPELPSSKDSSLNKPQTLAASSIYSMYTQQPGAAKPFQPGVQGALNRSQSRTNGFVSV
YGKPVIPSGGSPHPENPYLERRSPAPESEVDHSGANGVAPNPPEAPQPETERIPRPLSPT
KLLPFISNPYRHQSDGDLEALRKKLYNAPRPLKKRSSITEPEGPAGPNIQKLLYQKTTLA
AMETTVTTPTTPTFAGEAEKAPDDSVVPPAPSPLENNPPETGQMLEPENHSHISVIPESE
HIIPPPPPSHPAPRFDDALFPPPPPPGLDDLPNLPPPPPEGFLEEFPPYPPPPYPSGAEQ
DSLGDDTFNMKAPEITGQVTLPPGKRTNLRKPGSERIDHSMRVKFNPLALLLDSSLEGEF
DLVQRIIYEVEDPSQPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCA
ASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNR
GMVYALWDYAGENPDELAFHEGDCMTIVRREDEDETDWWWARMGDTEGYIPRNLLGLYPR
IKPRQRTLA
Download sequence
Identical sequences H3CTC3
ENSTNIP00000011507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]