SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011508 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011508
Domain Number 1 Region: 3-455
Classification Level Classification E-value
Superfamily Sema domain 6.93e-149
Family Sema domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 458-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000144
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 523-614
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000054
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011508   Gene: ENSTNIG00000008660   Transcript: ENSTNIT00000011690
Sequence length 795
Comment pep:known_by_projection chromosome:TETRAODON8:17:5693444:5698954:-1 gene:ENSTNIG00000008660 transcript:ENSTNIT00000011690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRFRSPAVNYSTVLLEAESQRLYVGARGAVFALNASDISASSALTIEWEASPEQKHQCLL
KGKDNKTECFNHIRFLQRFNSTHLYTCGTHAFRPLCAYIREEDFVMSSQPEEGRDKCPYG
PTTGHTGLIVDQQIYTASQYEFRSFPDIRRNSPSPTLRTEDAPTRWLNEADFVGSSLVRE
SVDSSTGDDDKLYFFFTERSQERTTTYSQGRVAAVARVCKGDRGGRLTLQKRWTSFLKAR
LLCYLHEYDFHFNMLRSVFVLHGQTPQDTLFYGIFGLEWKNVKASAVCRYSLSAVQEAFE
GPYMEMQGSRSEWKDYAGKIPEPRPGTCITDALRARGLNTSTALPDDVLNFVRRHPLMAQ
QVLPSYRQPVLFSRTTHYTHMAVQTTRGLDGRVYHVLYVATDQGWLHKAVDVGGQLHIIE
ELQAFEQEPINNVVISEKQMSVYLTSPSGVVQLPLSSCQRYVSCYDCIFARDPHCAWNQT
QCVEITSHANRSTLIQDIQLGNRGCVNTQKGMKKSRLLHLEKAVRVGDDALLQCELSSNL
ANPLWTLDGSQLQGYGLNSGYRTGTDGLLIIEAQLEQSGLYTCYAVENDVQVAVVSYRIL
VHQDPPLTPDVGGNENLEAIYLSLVTILGSLCVVLAVVLVYVGCCLKPEKRNNRKQKQHR
SSSLMELKTISSHCNGNGVCNGGSKLLNGGLHDAGFLQIVPGGGHQTPSKEPPPPAPPLP
PTPQLSSPECDFSGGLSATLPSVLRRMNGNSYVLLRQSDSESASPLCYSFAEELNRILEK
RKHTQLLPRPDESSV
Download sequence
Identical sequences H3CTC4
ENSTNIP00000011508 99883.ENSTNIP00000011508 ENSTNIP00000011508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]