SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011531 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011531
Domain Number 1 Region: 57-437
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.05e-46
Family Integrin alpha N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 564-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011531   Gene: ENSTNIG00000008683   Transcript: ENSTNIT00000011713
Sequence length 616
Comment pep:known_by_projection chromosome:TETRAODON8:17:5342266:5350448:1 gene:ENSTNIG00000008683 transcript:ENSTNIT00000011713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPELFPGSGSFSLQVSMLAWVLLFLPPVSSAQRSEPVFSSITKSILPPNYENNPTQLN
YGVAVTDVDGDGDLEVFVAGYNGPNLVLKYIQDQKRLVNIAVDNRSSPFYALRDRQGNAI
GVTACDIDGDGREEIYVLNTNNAFSGTAGRATYSDKLFKFRNGRFEDLLNDDINEHRDVA
NRMAGRSVACVDRKGTGRYAIYIANYASGNVGPHALIEMDELASDLSQGVIALSNVAEEA
GVNKFTVWAGGRGVVVGPILNQILPDVFCDNEYGPNFLFRNNGDGTFTDVAQQAGVEDPM
QHGRGVALADFNRDGRTDIVYGNWNGPHRLFMQLNNRRQKFKDIASQKFSMPSPVRTVIA
ADFDNDNELEVFFNNIAYRGPSANRLFRVSRREHGDPQIEELNVGEASEPEGRGTGAVAT
DFDGDGRLELLVSHGESAAQPLSVYKVLQGTSNSWLRVIPRTKFGAFARGAKVVVYTKSG
THTRIIDGGSGYLCEMEPVAHFGLGKDVATGVEVYWPDGRSVVRLLEPSDLNSVLEIQYP
RDVAESCALTGPTVLQCGHGFALNEKGRCTDEDECTRYPFACPLDRPVCVNTYGSYRCRA
KRRCNQGFEPSDDGSA
Download sequence
Identical sequences H3CTE7
ENSTNIP00000011531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]