SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011539 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011539
Domain Number 1 Region: 154-262
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 374-493
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 263-378
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 483-588
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000271
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 75-161
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000214
Family Cadherin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011539   Gene: ENSTNIG00000008690   Transcript: ENSTNIT00000011721
Sequence length 799
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:89508811:89516998:1 gene:ENSTNIG00000008690 transcript:ENSTNIT00000011721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRETPASKMGGRLRLWSVLLTAVLALLSLLPHSLLGNPAEEEVAERSLLLRRAKRGWVWN
QFFVLEEYTGLEPLYIGKLHSDMDKGDGSIKYILTGEGAGTTFTIDDSTGDIHAIQRLDR
EMKAQYILRAQARNRLTDRPLEPESEFIVKIQDINDNEPRFLDGPYWATVPEMSQIGTSV
IQVSATDADDPTYGNSARVVYSILEGQPYFSVDAKTGMLRVSLADMDRETRENYTVVIQA
KDMGGQLGGLAGTTTVNVMLTDINDNPPMFDQRLYQMSIPETAPVGSVVGRIWAKDRDIG
INAEMKYSIIDGDGRDTFDISTDPTNLFGIITVKKPLDFETKLSYTLKVEGANTHVDPHV
HHRGPFKDVTIVHVSVEDVDEPPLFDSPAYLLELSEDAEIGTVVKTVSARDPDSANNTVR
YSIERTSDLDKYFYIDITSGALMTVRTLDREEMSWHNITVLAMEMNNPSQIASASVAVKI
TDVNDNPPSLTQYLEAYVCENAKAGQLIQMVTALDVDEPQGGHRFSYSLAPEVADNPNFT
LRDNQDNTAWILTRRGGWSQQKQTVFLLPIVISDSEHTSTSTLTISVCTCDREGKVLSCS
AEAYSLPASLSTGALITILASIFVLLVLIQLMLTLCTHRKKKPCLYDVEENVHENIVRYD
DEGGGEEDTEAFDFALMWNLQEAHHPLGKMRQDMLPEIESLSRYVPQACVHGGGDSTVHR
YVLAKILEADMDLCTPPYDSLHIYAYEGEGSVAESLSSLQSGTSNTDHEYDYLNDWGPRF
GKLAEMYGVLEANSPPPGD
Download sequence
Identical sequences H3CTF5
99883.ENSTNIP00000011539 ENSTNIP00000011539 ENSTNIP00000011539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]