SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011583 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011583
Domain Number 1 Region: 154-266
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.4e-21
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 2 Region: 296-499
Classification Level Classification E-value
Superfamily vWA-like 6.67e-21
Family Integrin A (or I) domain 0.026
Further Details:      
 
Domain Number 3 Region: 18-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.23e-19
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011583   Gene: ENSTNIG00000008731   Transcript: ENSTNIT00000011766
Sequence length 558
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:90802292:90806984:-1 gene:ENSTNIG00000008731 transcript:ENSTNIT00000011766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HALSSPPESDMAAQCVTKVELTVSCDNLMDRDITSKSDPLCVLLMNSSDSKWYEVGRTEK
IQNCLSPKFAKKFLIDYYFEMVQKLKFGIYDIDNKTIDLSDDDFLGELECTLGQVVSSKK
LTRPLMLKSKSPAGKGTITICAEEINDSRVVNFEVEARKLDKKDFLGKSDPYLEFFKQTA
TGWQLAHRTEVVKNNLNPTWRPFRIPLQSLCGGDLDKPIKVECYDYDNDGSHDLIGIFET
TMTRLKEASRSSPAEFECINSKKKQKKKGYKNSGVVSVKSCQVVKEYTFLDYIMGGCQIN
FTVAIDFTGSNGDPRSPQSLHYISPQGVNEYLSAIWSVGNVIQDYDSDKMFPAFGFGAQI
PPSWQVSHEFPLNFVPSNPFCAGIEGVVEAYRVCLPQVKLFGPTNFSPIINHVARFAQQA
LQQTTASQYFVLLIITDGIITDMDETRNAIVNASRLPMSIIIVGVGRADFTAMEFLDGDD
GRLRSTAGEAAMRDIVQFVPFRQFKDVRGRLLRRHAPPEALAKSVLAEVPTQLVDFFNTM
KLVPPNSTGPAPNASETL
Download sequence
Identical sequences H3CTJ9
99883.ENSTNIP00000011583 ENSTNIP00000011583 ENSTNIP00000011583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]