SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011591 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011591
Domain Number 1 Region: 10-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.08e-22
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 2 Region: 284-468
Classification Level Classification E-value
Superfamily vWA-like 1.36e-19
Family Integrin A (or I) domain 0.022
Further Details:      
 
Domain Number 3 Region: 145-253
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-17
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011591   Gene: ENSTNIG00000008742   Transcript: ENSTNIT00000011777
Sequence length 533
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:90894042:90897856:1 gene:ENSTNIG00000008742 transcript:ENSTNIT00000011777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATNLATKVELTISCNNLMDMDVFSKSDPLCALYINTSGSHWHEFDRTEMILNCLNPRFSK
KFVIDYYFEVVQKLKFCVYDIDNNTYDLSDDDFLGELECTLGQVVSNKEMTRPLLLKNKR
PAGHGTITIYAEEITDNRVADFEVCARQLDKKYLWWSDPFLEFYRQTETGWQLAHRTEVI
KNNLNPTWRPFRVSLRTLCGGDVENTIKIDCYDHHVNGSHDLIGSCKTSLAEMQQGTHFS
PAEFECINPKEAQRKSYKNSGIICIKSCQILKEFTFLDYIMGGCQLNFTIAIDFTGSNGD
PRVPGSLHFINPEGYNEYLTAIWAVGNVIQDYDSNKMFPVFGFGAQVPPSWQVSHQFPVN
FNPSNPFCAGIEGVIQAYQRCLPQLKLWGPTNFAPIINHAACFARQALQQNMASQYYVLL
IITDGVITDMDLTRSAIVEASRLPMSIIIVGVGGADFSAMEFLDSDDRLLTSPRGDVASR
DIVQFVPFRDFQQGNSVALAQSVLAELPDQVTSFFNSYKLKPPMAPFFKQKKE
Download sequence
Identical sequences H3CTK7
ENSTNIP00000011591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]