SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011641 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011641
Domain Number 1 Region: 63-255,304-411
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.49e-40
Family Diacylglycerol kinase-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011641   Gene: ENSTNIG00000008792   Transcript: ENSTNIT00000011829
Sequence length 425
Comment pep:known_by_projection chromosome:TETRAODON8:13:2135714:2138292:-1 gene:ENSTNIG00000008792 transcript:ENSTNIT00000011829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVVKVFRTLRNHWKKSTFAVCVVSYGGHWLYGKHCDNVLRREACLLARDFGRQLIAPQ
EQLRKATVILNPAACNGKANNLFEKNAAPILHLSGVEMTIVKTDYEGQAKKLMELMEQTD
MLIVAGGDGTLQEVITGLLRRPDQDKMSNIPIGFIPLGSSNSLSPSLHLLSDNKVKDITS
ATLSILRGVTVPLDVLQIKGEKEQPVFALMGLRWGAFRDAAATISKYWYLGPLKKYAAHW
FTTLREWPLVREVSVSCLPPTLRPPDLPFEKPPRPSLLYRIARRLKNYWNPPIEEPPKAE
EPEQWKEEHLSTLELLVQTHNSNPVERRINDSLMICAEPDNFSVGEFITVGNTKIKDPAI
FSKHSTKLEVSACRLQLPEGAGGFYNIDNEEYEAMPVEVRLLPRKLRFFISAERSEQLLS
LMPGE
Download sequence
Identical sequences H3CTQ7
ENSTNIP00000011641 99883.ENSTNIP00000011641 ENSTNIP00000011641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]