SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011657 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011657
Domain Number 1 Region: 134-213
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000174
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000128
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011657   Gene: ENSTNIG00000008808   Transcript: ENSTNIT00000011845
Sequence length 214
Comment pep:novel chromosome:TETRAODON8:13:1767361:1790273:1 gene:ENSTNIG00000008808 transcript:ENSTNIT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVEFDDCTGNEDVRFEVSDPSFQVDENLNLVLLQDVLNTSPGLFIRGFGAHADDVAQVK
IMGAAVQPPHTLKLFKAKSSCPKHRKKFKRSLLVPPMIVTENQRAPFPRIIGRVISAEKS
RSHIFRLTGPGADQDPKGLFIIDMETGDVLVSRSLDREAIESYQLEVSTTDFAGNLVEGP
AILVITVIDQNDNRPIFKETHYTGEVLEGSPTGR
Download sequence
Identical sequences H3CTS3
99883.ENSTNIP00000011657 ENSTNIP00000011657 ENSTNIP00000011657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]