SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011732 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011732
Domain Number 1 Region: 129-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 2 Region: 32-100
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000132
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 3 Region: 225-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011732   Gene: ENSTNIG00000008879   Transcript: ENSTNIT00000011920
Sequence length 339
Comment pep:known_by_projection chromosome:TETRAODON8:2:18710001:18771849:1 gene:ENSTNIG00000008879 transcript:ENSTNIT00000011920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAFPSSLSDCQTPTGWNCSGFDDRDTDLFLCDTNTCKFDGECLRIGNMVTCICEFEFKC
NNDYAPVCGSNNQNYQNECFLRRDACKQQSEVLIMSEGACPADAGSGSGDDGGEGSAETV
QKETSTCDICQFGAECDVDAEDVWCVCNIDCSHISFNPVCASDGRSYDNPCQVKEVSCQK
QERIEVKHLGHCQASAGEIINEGKGKDTNTNFSALVEKDPHADSIYIPCPDHHKNYCVHG
DCKFPKILAQPSCRYCHPGFKGPQCDIKEYNVLYVVPGSGKLHYVLIASIIGALQVVIIC
VVVLCITRKCPRTNRINRQKQNNVHFSSENTMRASTRLI
Download sequence
Identical sequences H3CTZ8
ENSTNIP00000011732 ENSTNIP00000011732 99883.ENSTNIP00000011732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]