SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011736 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011736
Domain Number 1 Region: 416-591
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.34e-39
Family Tpt1/KptA 0.035
Further Details:      
 
Domain Number 2 Region: 3-179
Classification Level Classification E-value
Superfamily Macro domain-like 3.7e-38
Family Macro domain 0.00038
Further Details:      
 
Domain Number 3 Region: 207-347
Classification Level Classification E-value
Superfamily Macro domain-like 1.36e-26
Family Macro domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011736   Gene: ENSTNIG00000008883   Transcript: ENSTNIT00000011924
Sequence length 591
Comment pep:known_by_projection chromosome:TETRAODON8:2:18464821:18470722:1 gene:ENSTNIG00000008883 transcript:ENSTNIT00000011924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQTKEGLNIALATGKIEDATTDVIVNSVFKALNLKEGALSNAIFQAAGPQLQVLLNAKKS
SGTVGDVIVTEGCQLKSMFVYHAVTPAKGTAQDQAMKALSGIFRDCLNKAEDRGMTSISF
PTIGTGQLGFSKDHVAQVLYGEISKFSHKRQTKSLTEVTVILYSGDTETQQVFTEELKKH
FSKNTVSVGCTFNRCTICILGHFSKIITTSEMHETKMGSVTIQAVTGDITKETTDVIVNS
SNENFTLKRGVSKAILEAAGQAVEAECQKLEMKPYVSVIHAVAPRLDVDRTKHSKGVAQL
KKAIKGSLQLAERNNCVSVALPICGKSQAGVDSDTITDNFISSFSQADSQRITDIQVTLS
VRIMQESKQGTESLTIEGLGKDVLKASKKLANPQKLFLSTDEDIPTHWDVVINTSCHTVT
LAAGTAEYKRVQDKFQATCKQTIITIDRIQNPLLWKTLQMKKRNMDQKNGHQNNEKTLFH
GTTEDAVAIINEHGFNRSYAGKNAACYGNGTYFAVNATYSAKDLYSKPNQNGEKHMYLCQ
VLTGDYTLGKIGMVVPPPKTLNSCNDDEANPTIFVVFHDNHAYPEYLIKFK
Download sequence
Identical sequences H3CU02
ENSTNIP00000011736 ENSTNIP00000011736 99883.ENSTNIP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]