SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011737 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011737
Domain Number 1 Region: 43-228
Classification Level Classification E-value
Superfamily Macro domain-like 9.76e-51
Family Macro domain 0.0000758
Further Details:      
 
Domain Number 2 Region: 247-418
Classification Level Classification E-value
Superfamily Macro domain-like 1.46e-32
Family Macro domain 0.00059
Further Details:      
 
Domain Number 3 Region: 587-736
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000000000000393
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011737   Gene: ENSTNIG00000008884   Transcript: ENSTNIT00000011925
Sequence length 736
Comment pep:known_by_projection chromosome:TETRAODON8:2:18456502:18459304:-1 gene:ENSTNIG00000008884 transcript:ENSTNIT00000011925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSFLNHVLQRKFGCVATAIGVAFEGNQAVTQMKTPALVPEKRFEVLLPRVTVSVHKADLT
NFPVDAVVNAANERLQHVGGIALALSKAGGSQIQQDSDEYIRKNGVLRTGESVAMDAGSL
PCKKIIHTVGPHVTGHSLTASAANLLEKAVLNSLKKADECRLRSVALPAISSGIFGYPLK
ECADTIVKAVRDFCEKYQIMSLKDILLVDKVDLTVNEMERACRTCFSTNPASRSAGRDRK
NARTDQNSYTIQLRTVCLTLKWGRIDEEQTNVIVNTTQKDSWDGQISTAILKKAGTKMLK
ALKCANVGNRNVIVTEPYNLRCAEVYHTLFTAGSTDKAYQILTDAVSECLQLAANHSRQS
IAFPAIGTGGRGLEKEKVASIMSEAVFKFANQSSKQMEVYFVIYPGDHSTFQAFKEKMRS
LQQKTNRRTNGIALLLCYSAVTEQRDDFTGSGASTAKISLSGTSEESMREAHVWLTDILC
KPSPTRVVQNNFITHFGEEEYKQLTNIMQKNISIEEFLKQGQASVVLTGNPLEVSVAFLK
VEYLLCKIQENFVEEEVKMLTGFTNQILSYGRFQEDPIAHWSRTAYLNSGLEIVKVEHVR
NPTLWMFFELKKRQLNCPTTRKMFQRIPGHFCEMVSCIGFQAEFAPPDEPAHGQGIYFTD
TVPEAMDVWRQTFSEYLYFVEAEVLTGKSAPGKPDLILPPCVSADSRVRYDSVSGGHGIS
VIFTGFQAFPVYIITC
Download sequence
Identical sequences H3CU03
ENSTNIP00000011737 99883.ENSTNIP00000011737 ENSTNIP00000011737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]