SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011744 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011744
Domain Number 1 Region: 26-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-31
Family Ankyrin repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 279-324
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000209
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011744   Gene: ENSTNIG00000008891   Transcript: ENSTNIT00000011932
Sequence length 324
Comment pep:known_by_projection chromosome:TETRAODON8:2:18294918:18296763:1 gene:ENSTNIG00000008891 transcript:ENSTNIT00000011932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVSFVSPPGRNLKEWLQEQFCDKPLEQDDMRLHNSAYVGDLDTLRNLLQEEDFKRRINE
KSVWCCGCLPCTPLRIAATAHAVCVAYLISQGAEVDLVDVKGQTALYVAVVNGHLDCVRI
LLEAGANPNGSRHHRSTPLYHAARVGRLDILQELIRFNADVDMDHQLGPRLLLSARTLNT
LVVCPLYISAAYHHLDCFRLLLQAGAQPDFNYTGPVCQEALTRGLASCLLWNAVLRHGCE
GAFVHLLLDHGANPALVPWDESELEAPNRRKVDPEALRIFLEARRSPRRLTHLCRIRIRR
TMGKSRVSRVPSLPLPQPIKNFLL
Download sequence
Identical sequences H3CU10
99883.ENSTNIP00000011744 ENSTNIP00000011744 ENSTNIP00000011744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]