SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011748 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011748
Domain Number 1 Region: 25-169
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-22
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 2 Region: 230-366
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 399-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 4 Region: 362-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000317
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011748
Domain Number - Region: 434-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011748   Gene: ENSTNIG00000008895   Transcript: ENSTNIT00000011936
Sequence length 458
Comment pep:known_by_projection chromosome:TETRAODON8:10:2337234:2340704:-1 gene:ENSTNIG00000008895 transcript:ENSTNIT00000011936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMDMLLIFLWLLADTLNSTSSAEQETLCTNSTCFTVHMVKVSFEVARQSCEHSGGYLMIV
RDEEEENVLRCLLSKIRRQHQERAKTFWIGLKLHKGDCVLADEALRGFRWISGEDSSYSN
WKKEPVRTCTSEKCVSVLHTSSEKQLKWTAGQCALSRFYVCKFYFQGMCKSLTLMGSGQV
SYTAPFSDKPQSYKMQLLPFGTYAEISCSNQQSQSSVCRETEHGYQWTDPGPFCKAEEQN
CMIHNGGCEHLCQQEAGGVQCYCKEGYSLEEDGFSCRSAETDECEQLRCHHGCSNHSGSL
SCCCEQGFSLSEDGRSCVDINKCDNGVCQIRCVNNEGSLWCTCYSNYYITKELLDSCVIS
AEGCLTGPCEHVCTDVKGGFTCSCFAGFIPDRKDPKRCKLHCAQKKCPAVCDVETGGSCY
CPEGFIREDNFCHDFDECFTQGCDHVCHNTYGSFKCSC
Download sequence
Identical sequences H3CU14
ENSTNIP00000011748 99883.ENSTNIP00000011748 ENSTNIP00000011748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]