SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011763 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011763
Domain Number 1 Region: 651-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-74
Family Protein kinases, catalytic subunit 0.000000226
Further Details:      
 
Domain Number 2 Region: 50-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-20
Family MAM domain 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011763
Domain Number - Region: 10-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00111
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 548-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011763   Gene: ENSTNIG00000008909   Transcript: ENSTNIT00000011952
Sequence length 1144
Comment pep:known_by_projection chromosome:TETRAODON8:10:1709046:1751332:-1 gene:ENSTNIG00000008909 transcript:ENSTNIT00000011952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAGPNITLEGRYHCYQGPAISLDRLCDFTRDCPLGDDEGDHCRDFLNGSYCSFEDGDCS
WKPIAGRTLSWKRLQSSAKPPRQSCPSSGATFSVEGGHAKGQRGSALLRSPLFPPPLRNS
PCTVRFWLCSRGLHKGSLSLWLLENSTGPEEQRPLWSSASEAKSEKSWKLITLPLYGLAD
WFWLQFSTENGPGPGSSVSLDNISFSMDCFLACEYTYNNLQTEAARATNIARGNEVKWLS
PVIPRPPPSGNAAKKWIFQTCGARGPEGPTHTQCLNSYRKNNVSVTVAAQGPLKGIQKWK
VLETGTYRITAYGAAGGRSVLVMSRSHGVYLAGDFWLKKGEELYILVGQQGEDACPSSNN
ILNKICQEQSGPMVNKTQVKWGGGGGGGATYVFKVDNGVYVPLIIAAGGGGRGYSSQAET
QLEQMDYESSQHGRNGKSYAAGGGGGWNDSAPISQGGRPLVLGGQGGQACQHFSQTRGGF
GGGGGGCLSGGGGGGYRGGNTSIENNPRHDGDDGTSFLSQLGVPFLSIPLKAIDGDGEVI
IGPVQNCSHCESGECYDAKDGIVCFCEEDLILAPDRVSCIKVTVLPPQASLSHLALGLSV
GTSALIAALLLAVSGVMIMYRRKHTELQSIQLELQSPDCKLSKLRASTIMTDYNPNYCFA
GKTASVNDLKEVSRRNISLTRGLGHGAFGEVYEGLAVGIPGEPSPLQVAVKTLPEVCSEQ
DELDFLMEALIISKFSHQNIVRCVGVSLQAMPRFILLELMTGGDLKTFMRETRPRPEHPS
SLTMVDLLNIARDIAKGCQYLEENQFIHRDIAARNCLLTCKGPGRVAKIGDFGMARDIYR
ASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSRSNQEVL
EFVTNGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFSTILERIDYCLQDPDVVTMPLPV
QYGPVPEEEEGAALRSDEPSAPAVLVNAQVPDGEARQPAPSRSPEETCNGGEHPVVAGAA
SEAKAQVASQPGTEGGHINLAFTQGHQPEKDGHNGKSTSLWNPTYGSWFLQQKKQKQQRQ
AGVGAAGGNGGGLCRPLLPPPPPPTVQSPLLLDTATLPPVPLYRLRIPCGNIGYGYQEAG
VTLD
Download sequence
Identical sequences H3CU29
ENSTNIP00000011763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]