SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011766 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011766
Domain Number 1 Region: 76-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-82
Family Protein kinases, catalytic subunit 0.00000299
Further Details:      
 
Domain Number 2 Region: 960-1028
Classification Level Classification E-value
Superfamily G protein-binding domain 1.02e-27
Family RhoA-binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 1137-1226,1306-1336
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000375
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 4 Region: 1253-1303
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011766
Domain Number - Region: 419-528
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00254
Family Myosin rod fragments 0.003
Further Details:      
 
Domain Number - Region: 1048-1109
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0209
Family Myosin rod fragments 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011766   Gene: ENSTNIG00000008912   Transcript: ENSTNIT00000011955
Sequence length 1373
Comment pep:known_by_projection chromosome:TETRAODON8:10:1663655:1682762:1 gene:ENSTNIG00000008912 transcript:ENSTNIT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGAERRLESRLRKLEDMIRDPKSAINLESLLDSINALVLDLDYPALRKNKNIEVFLNR
YEKVIEQTRDLQMKSEDFEKVKIIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAFANSPWVVQLCCAFQDEHYLYMVMEYMPGGDLVNLTSTYDVPEKWAKFY
TAEVVMALDAIHSMGFIHRDVKPDNMLLDRNGHLKLADFGTCMKMDSTGMVHCDTAVGTP
DYISPEVLKSQGGDGYYGRECDWWSVGVFIFEMLVGDTPFYADSLVGTYSKIMDHKNSLN
FPDDVDISKNARNIICAFLTDREVRLGRNGVEEIKQHPFFKNDQWTFDTIRDTVAPVVPE
LSSDIDTSNFDEIEDDKGDVETFPTPKAFVGNQLPFVGFTYFKENQLLNASNNISVTNEN
SKEESAELQKKLHHLEVQLNNEKQHTGDLEHKYRSVSNRLEKIIKELEEEVGNRKSLESS
LRQLEREKALLQHKSLESHRKAESEADRKRCLENEVNGLRDQLDDLKRRNQNSHISNEKN
LHLQKQLEEANTLLRAETEAATRLRKTQTESSKQLQQLEANARELQDKCCLLERSKLSLE
KECISLQAALETERREHSQGSETISDLMGRISVLEEEARQQRQALSKMESEKRQLQEKLT
DLEKEKSNKEIDLTYKLKVLQQELEQEETSHKTTRALLADKSKIKVTIEGAKSESMKETE
QKLAEERAAKIRLENRILELEKHSSMMDCDYKQALQKLDELRRHKDQLTEEMKNMTLKIE
QETQKRSLTQNDLKAQNQQLSSLRTSEKQLKQEMNHLLDIKRSLEKQNQELRKERQDADG
QMKELQDQLEAEQYFSTLYKTQVRELKEECEERNKLYKEAQQSLQEMQEERDSLAAQLEI
TLTKADSEQLARSIAEEQYSDLEKEKIMKELELKEMMARHRQEVAEKDITISSLEEANRT
LTSDVANLANEKEELNNKLKAAMEESQKSNDWEQQICQMKQGFEKQLQSERTLKTQAVNK
LAEIMNRKEIRGGGSRRGNDTDMRRKEKENRKLQLELRSEKEKLNSAIIKYQKEINEMQA
QLSEESQMRIELQMALDSRDSDIEQLRNYLQSLSVPSLDAASVNSGPEFDADDAYTESRL
EGWLSLPVRNNTKKFGWVKKYVVVSSKKILFYNNEQDKEQSIPYMVLDIDKLFHVRPVTQ
TDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPLPIGEKSSYICHKGHGVHSFATNCE
ACTKPLWNMFKPPPALECRRCHIKCHKDHMDKKEDIIAPCKVNYDVSTAKNLLLLAISQE
EQQKWVSRLVKKIPKKPPPAENFLRSSPRTSMKVQPSQSMRRPSRQLPTSKSR
Download sequence
Identical sequences H3CU32
ENSTNIP00000011766 ENSTNIP00000011766 99883.ENSTNIP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]