SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011780 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011780
Domain Number 1 Region: 215-357
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-39
Family Third domain of FERM 0.0000115
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-37
Family Second domain of FERM 0.00000386
Further Details:      
 
Domain Number 3 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.4e-24
Family First domain of FERM 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011780   Gene: ENSTNIG00000008927   Transcript: ENSTNIT00000011970
Sequence length 800
Comment pep:known_by_projection chromosome:TETRAODON8:9:1981295:1995811:1 gene:ENSTNIG00000008927 transcript:ENSTNIT00000011970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDHGEDDSSEKTPSKASKSPQKSTKRPKTIPVKVSLLDGSDYEAAVEKFAKGQTLLDMVC
GHLNLLERDYFGLTFQDTDNSKNWLDPSKEIKKQIRAGSWIFGFSVKFYPPDPSVLIEDI
TRYYLCLQLRDDILSGRLPCSFVTHALLGSYTVQAELGDYESEEHGPDYVSDFHFAPHQT
RELEERVMELHRNYRGMSPAEADLNFLENAKKLSMYGVDLHQAKDSEGIDIMLGVSANGL
LIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVC
IEHHTFFRLVSPEPPPKGFLVIGSKFRYSGRTQAQTRQASALIDRPAPQFERSVSKRHML
PRSTDGEDLDQEGSLDLDHEQDRDLDESIDQELEHSQAEEKAQRNVSTPTKTLEVKPAVL
THPQHCEQQFLDKPEDVLQKHQASINELKRALKQPNSKKAPREKRVSSATPPGGTPERKP
VRAPATPSSGKQETPPTPAIHEEPLSEDSDDQDHDMPYLKETHLGIERKCSSITVSSTSS
LEAEVDFTVLTDLQTGMEEFSRGMSELGDRNLSPDGGLCFSIDFLQPQAPPEPPAPLMAA
PATRAAGSSPPAKHSGAEEVRTRPEGQPAVPKKPKRSVPVSSSVDREAGRIAAIAPLSRE
ASDVTPTPAVRKTDVRTETQPNGSEVTTTIVEFTDQVAQLITLTQRTQRRESAGSPILVA
ENVTSATTHVTKTVKGGYSETRIEKRIIITGDDDVDQEQALAIAIQEAKQQHPDMQVTKA
VVVRETESSAEERHAKPDHS
Download sequence
Identical sequences H3CU46
ENSTNIP00000011780 99883.ENSTNIP00000011780 ENSTNIP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]