SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011807 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000011807
Domain Number - Region: 141-171
Classification Level Classification E-value
Superfamily Plexin repeat 0.0889
Family Plexin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011807   Gene: ENSTNIG00000008953   Transcript: ENSTNIT00000011997
Sequence length 338
Comment pep:known_by_projection chromosome:TETRAODON8:1:1371973:1375226:1 gene:ENSTNIG00000008953 transcript:ENSTNIT00000011997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEVCWNMALSRGLRCCQRVFSWIPVLIITSVVLWSYYAYVFELCLFTLNNTIEKVVYLLV
FHVCFMMFCWTYWKSIFTPPSSPCKKFQLSYSDKQRYEMEERPDVQKQILGEIAKKLPIF
TRAQSGAIRFCDRCQVLKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLSY
SILYCVFIATTVCQYFLKFWVGKLPNGHAKFHVLFLMLVAVMFFVSLMFLFGYHCWLVAK
NRSTLEAFSAPVFVSGPDRNGFNVGVRRNVQQILGEDRRLWFIPVFTSQGNGHYFPLKNQ
SSESHNPLLASEDLWEESEEGSEAEGQGNSISRTQNPT
Download sequence
Identical sequences H3CU73
ENSTNIP00000011807 ENSTNIP00000011807 99883.ENSTNIP00000011807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]