SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011841 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011841
Domain Number 1 Region: 298-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-54
Family SPRY domain 0.0000518
Further Details:      
 
Domain Number 2 Region: 23-94
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-19
Family RING finger domain, C3HC4 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011841   Gene: ENSTNIG00000008987   Transcript: ENSTNIT00000012031
Sequence length 487
Comment pep:known_by_projection chromosome:TETRAODON8:1:2127830:2130572:-1 gene:ENSTNIG00000008987 transcript:ENSTNIT00000012031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPAPDALPAAVSAPTLSKISLRDDLTCAVCCDLFREPVMLACMHHFCKLCICQYWGE
TEGRVRCPQCRQEFGSKHFQTNYLVSSIVEKIRVATSDSYIQNVQINRHSLIFLYCMFSG
PICVSFTVVLPNWVPLTRSSQNPQKQLREMLESHHLRKEAFIKSVSRDKDKMDAIKRVAA
DLQARIKGDFGALHQILHDEEACLLEQLKKEQAEELEKAQRHLEAAQQGLRQMEDNLRVL
QEAGAAADSQILTEGSDVCFVFHSPCPKLDAAPEFDANLFSSKYVAPLQYIAWRKMFKSL
KPGPAPLTFDDDTAHRSIRVSVDRTSALELDDVRVYPDSNKRFLQCVNILASQGFQSGRH
YWEVEVGSKRKWDVGVASESVDRLGKIKLSPENGYWTLRMRNGDECWAGTQPWTRLRPSS
APQRLGVFLDCEERRVSFYNADDMSLLYSFTDGPRSKAFPFFSPCVNDSRDPPQPIRLLH
YPPVPLS
Download sequence
Identical sequences H3CUA7
ENSTNIP00000011841 99883.ENSTNIP00000011841 ENSTNIP00000011841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]