SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011850 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011850
Domain Number 1 Region: 355-675
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-82
Family Ankyrin repeat 0.00000659
Further Details:      
 
Domain Number 2 Region: 1042-1371
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.11e-81
Family Ankyrin repeat 0.00000764
Further Details:      
 
Domain Number 3 Region: 190-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-41
Family Ankyrin repeat 0.00034
Further Details:      
 
Domain Number 4 Region: 1677-1748
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011850   Gene: ENSTNIG00000008996   Transcript: ENSTNIT00000012040
Sequence length 2517
Comment pep:known_by_projection chromosome:TETRAODON8:1:2401444:2419807:-1 gene:ENSTNIG00000008996 transcript:ENSTNIT00000012040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTDGFEDEIDSVTPRSPVAGMGVGATPGGVGLGGIGIGVGGKKVRLYGEPSGPAAERLD
FKLAAAAVLSSGPGSGSDEDEVSEVESFILDQEDLDNPIMKTASELLLSSATDGVDLRTV
DPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAENT
LNAGQADNRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLL
AMHANVEDRGIKGDITPLMAAASGGYVDIVKLLVHGADVNAQSSTGNTALTYACAGGFID
VVKVLLKEGANIEDHNENGHTPLMEAASAGHVEVARVLLEYGAGINTHSNEFKESALTLA
CYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFE
SPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINA
QTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGA
NVHATTATGDTALTYACENGHTDVADVLLQAGANLEHESEGGRTPLMKAARAGHLCTVQF
LISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGG
HTNVVSYLLDYPNNILSVPAPDLSQLTPPSQDASQVPRVPFQALAMVVPPQEPDRAPSNI
STPQPVSSKGISKQRQAALQPGVAASVGRGPDAEPLPPFHLCQPLECIVEETEGKLNELG
QRISAIEKAQLQSLELIQGEPLTKDKIEELKKSREEQVQKKKKILKELQKVERQLQLKTQ
QQFTKEYMEAKGLKEEQEAGHSQGPGPGQGSEDEADGEEENYPKLPQVGTILYRDVPQPP
QQPPLPPSSQTQPQPPPPPLQTAFVPIQPLPDYNPTDYPGSPSPELQRVLVGQQGQQLAG
LSPGMIPQQAPDGLMVATPAQTLTDTLDDIMAAVSSRVPMLNATTSPTPLSQPPTQMPSN
IASPPSVLPLYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARGANIEHRDKKGFTP
LILAATAGHVGVVEVLLDKGGDIEAQSERTKDTPLSLACSGGRQEVVELLLLRGANKEHR
NVSDYTPLSLAASGGYVNIIKILLNAGAEINSSIRTGSKLGISPLMLAAMNGHVPAVKLL
LDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGGY
AEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLINRGAHIDVRNKKGNTPL
WLAANGGHFDVVQLLVHASADVDAADNRKITPLMAAFRKGHVKVVQYIVKEVNQFPSDIE
CMRYIATIADKELLKKCHQCMETIVKAKDQQAAEANKNASILLKELDMGEEESKKQALAA
KGQKTKEDSSEMQEQKENCETQNEEGKPQHPPEAEVPIEPPSATTTTTIGISATSTTFTT
AFGKKRASVATTPSTNRKNKKNKTKDSSPSEPIILQDPQVALAQHKADKNKIHGEPRGGG
GGVTGGNSDSDPLDSTDCASESSSSGSKSQELNYLPDLAPSSGATQPHILLRGPEKRHCP
QLQPERTPDAVDSTSNSLPSPFKSMALPITSPNSKLSLTSPKRGQKREEGWKEVVRRSKK
LSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRYAVQLI
NALIQDPAKELEDLIPRNHIRAPGSKTTSASFTSTAGSTSASATGPKALNSLVTPTGVSF
QTSSSSPSSSSQAGGKMGKGLSSNVRQPFPVSLPLAYAHPQLALLAAQTMHQIRHPRLPM
AQFGGTFSPAASTWGPFPVRPVSPGQREQLPQTHRRSQQQRRTAPARPNSAHADHSSTSS
SAHVGSNLQTPSPPLLLTPIPTPSSVRKQLFTLDPKPTSVAAASSNGSSAVRGTGSPAHQ
SSTSTTAIAPQQPVGTISQPPIQPSKTESSAAPTPGKDKPALAAENQPASVTDGMNSVGF
SAPAMTMSAKAEPLQQLPPPPASLPSSEAPPALLNPQISSHLPTVPPPVLSHSVAHPNNT
VPHFSAPAPRVSHRMQPTGPYYSLSEQHQTQQHPTQQQQSVFVPTSQPTTLPPPAQTQTQ
GSLQVSPNLGLMNGSQMHVASTGKPQQIPANFGPAGLFNFSSIFDNNNQVGNNHVWGALP
LPARSPPEQSYSAPPAYMSVSQMENMMPPPPPDSSKAPGCRSASQRMVNSPIGRHSFATS
ISGSPVYLHGHTAVGTPSFNRQHFSPHPWSASTQAAVAPPPQQKPGSSLHQDRKVPPPIG
TERLARIRQTGSVNPPLLTTSYTASVGQGGIWSFGVGSASEAMSGWSQPLINSHMMHPQL
QAEQSAFSQHQPMEQDDTGIANPANSYHQPQHLPSSYMDFSKGLPMSVYGGTMLPPHPPM
AEGPGGPMYNGLHTADPAWSPIIKVVPNNADSSDPQQQVWPGTWAPHVGNVHLNHVN
Download sequence
Identical sequences H3CUB6
ENSTNIP00000011850 ENSTNIP00000011850 99883.ENSTNIP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]