SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011880 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011880
Domain Number 1 Region: 208-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-44
Family SPRY domain 0.00028
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000183
Family B-box zinc-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011880   Gene: ENSTNIG00000009024   Transcript: ENSTNIT00000012070
Sequence length 380
Comment pep:known_by_projection chromosome:TETRAODON8:4:2803801:2806419:1 gene:ENSTNIG00000009024 transcript:ENSTNIT00000012070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELCVEHEAELDWFCGTEQKVVCSLCTVAGPCQGHAVTPLADRVTAVRYFLLIHCMVFQKT
GFSCWGYNVVSGVAVLWANRKRQQVFARISAAREALEEEEQRLLEEVQREEERVEQCLLT
HRAHWSQALENLSQTRSSLVHMLTHAADTHLATSSQEIAERVEETEGVGEPCDTDKLNLN
PNCGDSRLLRGLWAAAVLLGPNGYGSPHLKFDERTVSPLLSLSDDFCTVTFLHKKPRQAV
RYDPARFDCWPNVLGSLSLSSGTHSWVVDVGQSDAFKVGVCYASLERKGSGNEARLGHNS
QSWVLSRFAGDYSFFHAGQKVPLQVVKGPQRIGVLLDWPSQTLLFYEADSGAVLYTLTHP
FSSPLLPACAVSDCSVTILH
Download sequence
Identical sequences H3CUE6
ENSTNIP00000011880 99883.ENSTNIP00000011880 ENSTNIP00000011880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]