SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011888 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011888
Domain Number 1 Region: 23-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-72
Family Lectin leg-like 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011888   Gene: ENSTNIG00000009032   Transcript: ENSTNIT00000012078
Sequence length 324
Comment pep:known_by_projection chromosome:TETRAODON8:4:2738634:2740641:1 gene:ENSTNIG00000009032 transcript:ENSTNIT00000012078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAFVILVLTASLCFADDDHEMEEFLKREYSLSKPYQGVGSLGSSHWELMGDAMVTTEQVR
LTPDMQSRQGAVWSRVPCHLKDWEMQVHFKIHGQGKKNLGDGLAIWYSKERMQKGPVFGN
MDNFTGLGVFVDTYPNEEKHLEAQKKRYTPRTQRIFPYVLAMVGNGTISYDHERDGRPTE
LGGCNAMVRNLKHDTFLFIRYIRRRLTVMIDIDGQHEWRDCLDLPGVQLPRGYYFGATAL
TGDLSDNHDIISLKLYELTVIRSDITIPSVDNIELLRLGSAEEGMSSITMFFTLLFSMLG
CIFLIIIGIVMYGQWKESRRKRFY
Download sequence
Identical sequences H3CUF4
ENSTNIP00000011888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]