SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011921 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011921
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-30
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 134-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-18
Family Ankyrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011921   Gene: ENSTNIG00000009062   Transcript: ENSTNIT00000012111
Sequence length 749
Comment pep:known_by_projection chromosome:TETRAODON8:4:2065166:2070887:1 gene:ENSTNIG00000009062 transcript:ENSTNIT00000012111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRVRSREVCADCSAPEPRWASVNRGVLICDECCSIHRGLGRHSSQVRHLTHSLWPPSQ
LQMVQALYGNGANSIWEHSLLDPSSAMSGKRKANPQDKVHPNKTEFIKAKYQMLAYVHRM
PCREDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHIAARAGQV
LQAELLAVYGADPGALDSSGKTPTDYARQAGHHELAERLVEIQYELTDRLTFYLCGRRPD
HRSGQHFIIPQMADSSLDLSEFAKAAKKKLQSLSNHQFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTDTTVVPFLPVNPEYSSTRNQGRQKLARFSANEFATLVIDILNDAKRRQWGN
SCESPKDNVELILQGIDGRHDSESQDNDQPDYDSVASDEDPVPEATCGDSSTESSESSDL
SDGPITVQEFMEVKSALTASEAKIQQLLKVNCHLSEELRLMQSKLNSLQTENTTLRWQAP
GGQQPLQGPFNRHPPRGGRAMSMYETGYSAKQYPHRVEMGRHEDGVILQPFPSNIGRGPL
GTAASSLPTFPSSLSWSWDERSRRGCSLEGQTVAQESDYDTTPSRSEPEETGEVLGGKGA
HPQLAGSSPLPAPDAAQPGEEGGEEAAMPCTEDVICKTEQITKNIQELLRAAQETKHESF
LPCSEKIRLAVTEMAALFPKRPSSETVRGSLCLLTASASRLHGECQKAAEHSPCPSDIQL
VTQQVIQCAYDIAKAAKQLVTVTTKENNN
Download sequence
Identical sequences H3CUI7
ENSTNIP00000011921 99883.ENSTNIP00000011921 ENSTNIP00000011921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]